SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0193196 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0193196
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.47e-29
Family NodB-like polysaccharide deacetylase 0.017
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.59e-16
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0193196   Gene: FBgn0166662   Transcript: FBtr0194704
Sequence length 486
Comment type=protein; loc=scaffold_55:complement(135831..136158,139993..140378,143191..143410,160406..160548,165739..165866,173794..173905,173988..174079,181163..181214); ID=FBpp0193196; name=Dsec\GM11719-PA; parent=FBgn0166662,FBtr0194704; dbxref=FlyBase:FBpp0193196,FlyBase_Annotation_IDs:GM11719-PA,GB_protein:EDW53805,REFSEQ:XP_002044556,FlyMine:FBpp0193196; MD5=ac9a2323e84adfdde401695e01679d03; length=486; release=r1.3; species=Dsec;
Sequence
MLRQCLVTVLLVIAGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCP
SGLFFDDLQKFCTFKDEAKCGPLPTTPAPATEAPADTAQRCNTENCALPYCFCSKDGTQI
PGDLEPEKIPQIIMLTFDGAVNLNNYQHYQKIFDGKRKNPNGCLIRGTFFMSHEYSNYQQ
IQHLGYYGHEIGTESISQQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVGMRAPFL
KPGRNTQYKVLEDFGYIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGFEGGHCPYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALELPDVYILTVTQMLQYVTDPKELRDVSQIESWKCDKSVSVAPKP
CNIWQTCALPFKIPEQNLTDTRYMETCRECPNVYPWLGDAGGTGIAGRDNYIFAGGENPE
EEDSAK
Download sequence
Identical sequences B4ILE6
FBpp0193196 XP_002044556.1.34323 XP_016040360.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]