SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0193938 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0193938
Domain Number 1 Region: 98-276,312-368,738-776,1079-1216,1298-1318,1371-1419
Classification Level Classification E-value
Superfamily ARM repeat 0.000000346
Family HEAT repeat 0.085
Further Details:      
 
Domain Number 2 Region: 586-688
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000628
Family Sec7 domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0193938   Gene: FBgn0167398   Transcript: FBtr0195446
Sequence length 2049
Comment type=protein; loc=scaffold_4:complement(822538..825438,825508..825943,826007..826360,826445..827722,827788..828108,828166..828806,829332..829465,830256..830340); ID=FBpp0193938; name=Dsec\GM12461-PA; parent=FBgn0167398,FBtr0195446; dbxref=FlyBase:FBpp0193938,FlyBase_Annotation_IDs:GM12461-PA,GB_protein:EDW52988,REFSEQ:XP_002036829,FlyMine:FBpp0193938; MD5=a660206ea59dd7e9562818fb07704077; length=2049; release=r1.3; species=Dsec;
Sequence
MEDLFLLIIKESTGTKHNALRQTAQIAYDKLYRQHGIHRDPSHELRSVCFTALQMALDTK
RPKFITMGLNGLHRVIKDERFYIGLEPEDDSVWLPSQLLRATNGILPTTSSEDTVVNVLR
LFLAMACSPACTLNGRLLIEILSRCGECWEMGSRATKAASLAAASQCLRTFCAFLIEEAE
EVKKTAPAGLMTQTQASAVYNEVIPVMQWLCSRLVEPNVNASPNKKCENHSSLYLTECIL
TLSSALPRNVHANPHFTSFLWQKFCPTLAAALGSPGRINLDKKFTYKDALHMIENEARGF
FTGPGLDGPQARCVYLTAIQLLRIAGAHGSLRPMLEALFHRMLLLPAPQNRTEPLRCVRE
IFKSPERLIDLAVILYVDKNTAQGCSDEMALFRLLVDAMEECAYGASGVGSATEASLQAS
VECMVALLDSLQVLCSGELTESMISDQIVQVVNGRHDLLKDADYSGPLTYQSMARLPAPY
RDAIVEFRQTVFETSSGSESEGEPQHEQDAASNGSGDTEGPEDDDPSSSSDETSRVENRW
PYSHLEAPVMPIRTDSDNDRQHARDFARALRQDLVPKLLRLRSCVELDEAMQEFASAVCQ
ENSMNFSDFDYNLTAINADGIYLAIYSSLLLSLQLMRAGYYEQVAQGMSHKDILVPMSEQ
QFVTSVQNTGVLVYLSSPWLCELYQSVTVCNVLEAMPRQQLEGMGPRCALVDMLCDAGGL
GATQMLSEWQRLQTANVKHKEEEQLHDKRREAAKKLCRRLLTCCWDSMVIVLSSGLGDLQ
TSSASNKLVALSKRTLRVKAKANKSNGEALYAMCLDGCIRNSLNLQHLAGKILNLLASNV
CQTSGPRISASQAMSMDVVLTGGLNLGSYSADCWPSIFAVCRHVSQLEHEIFSMQNPAIS
ASPGSSRRDLETGEKLSNGNAQDKLNLSSIPIDDDETCVDVYSFLQAPMQSPNTNITSIL
KVYSGTNETVLLSQSDTSKVLCALSHQAENLFGDAAERLSLPSLCQFLKHLCRASRDQLY
KSQVASKGSRIWWPSKGWKKLDSLPMSLLLHRIGDVTLKVFRSSRPLLHVLKVWAITGPH
LMDAACHRDRMISKRAIEYIHDIITALLVEQSELPYFHFNEALLKPFENLLSMDTDVDVQ
DQIVACLYEVVEAHRTEIRSGWRPLFGTLRNARSRMLNMSNIIDIFRVFLDSDNTLVFAN
AGLDCILCLLSYLEISGGGNNNACSGGSGSAAGGTASSGGQQEEDNTFRPTDFLHETLRF
LERCSSILGFMQSMPKCPNFHSTYKIKGISYTHIIDANIPSSMENFTYFGNDYLQTRNEQ
YMISYRSLHIDKDTIVKIDEMDKPSGVLKVWFLLLDGLTNSLIVCPYSHQAPILQTIFKL
FKNLLASPGIDFGFYCINHLLVPMIQDWLRYINKTGSSWQLVEKNFKHCCCMTTDLVVEF
IEKSVPEQRRLGAGTKTRLAQIVHPADNLLYSKLKFVTERIEREQQQQQQSPSVQDHGCG
YTQQYDSSSSSASEEQQKNGEGVGGGGANLIESPTKISGSATLALKQLLLVLIECAAQSQ
EAIARISVSCLKHVILSTGMLFNESQWMIACSAIHRACTVTIAPLRQLSFAFHEKSNSFY
GDCANVKVAARRDSSLEELARIYALAQQVFLSDNQREPGQNQAPTPSASQCKLSDDRSYS
FLLYPLNNGFNSNLDNFVIRIPFKNLVVGLLANQMLLQLVAKLLLSRLKCVPQAVSTCIF
DNYAASAASPSHDYDLDFRSKEILLRCVKQYLMSALEFDSRPGLKFLMQKVSNIEYAANL
YKQMTSSWMIYYIALVDSHLNDIVVYNLGPEDLNFILESCSRLNTTTVKKKENFVRYLFC
LQDAWNLVCELYLSNSALHEIESGSGKLRQKPPQLLHHPQTKPMCISLNGNGDAEMTDTG
SGSGSGSGSSTSPSKCVRLQEEENVTMTTLISEFQPKCRSNPFDTNRQAKSSEAESISPE
IEQQRASSILKDSNYKRAALAQLVVASMELLRSLPGEAEENLKLLMTPTIREAFRLVQLQ
GNELKVNQF
Download sequence
Identical sequences B4I0F7
XP_002036829.1.34323 FBpp0193938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]