SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0194236 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0194236
Domain Number 1 Region: 207-466
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-59
Family Nuclear receptor ligand-binding domain 0.00000019
Further Details:      
 
Domain Number 2 Region: 138-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0194236   Gene: FBgn0167695   Transcript: FBtr0195744
Sequence length 703
Comment type=protein; loc=scaffold_3:complement(4169140..4169186,4169251..4169910,4169983..4170219,4170283..4170420,4170481..4170977,4171189..4171627,4186057..4186150); ID=FBpp0194236; name=Dsec\GM12759-PA; parent=FBgn0167695,FBtr0195744; dbxref=FlyBase:FBpp0194236,FlyBase_Annotation_IDs:GM12759-PA,GB_protein:EDW52184,REFSEQ:XP_002036261,FlyMine:FBpp0194236; MD5=98380b8224fae29dd4771b680ec85236; length=703; release=r1.3; species=Dsec;
Sequence
MKHPQDLSVTDGQQLLKVNKVEKMEQEVHDPESESHIMHADALASAYPAASQPHSPIGHA
LSPNGGGLGLSNSSNQSSENFALCNGNGNAGSAGGGSASRGSNNNNSMFSPNNNLSGSGS
GASSSQQQLQQQQQQQSPTVCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFA
RNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLV
KAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQL
DDQVALLRAHAGEHLLLGLSRRSMHLKDVLLLSNNCVITRHCPDPLVSPNLDISRIGARI
IDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQY
ESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNPLPLSP
PNQSNDYQSPTHTGNMEGGSQVNSSLDSLATSGGPGSHSLDLEVQHIQALIEANSADDSI
RAYAASTAAAAAAAVSSSSSAPASVAPASISPPLNSPKSQHQHQQHATHQQQQESSYLDM
PVKHYNGSRSGPLPTQHSPQRMHPYQRAVASPTEVSSGVGGLGLRNPADITLNEYNRSEG
SSAEELLLRTPLKIRAPELLTAPAGYGMEPCRMTLKQEPETGY
Download sequence
Identical sequences B4HYQ4
FBpp0194236 XP_002036261.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]