SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0194386 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0194386
Domain Number 1 Region: 51-130,160-237
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.57e-26
Family Nuclear receptor ligand-binding domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0194386   Gene: FBgn0167841   Transcript: FBtr0195894
Sequence length 241
Comment type=protein; loc=scaffold_4:join(5503403..5503478,5504265..5504914); ID=FBpp0194386; name=Dsec\GM12909-PA; parent=FBgn0167841,FBtr0195894; dbxref=FlyBase:FBpp0194386,FlyBase_Annotation_IDs:GM12909-PA,GB_protein:EDW53567,REFSEQ:XP_002037408,FlyMine:FBpp0194386; MD5=7ff59e190946bd9514b788a2646f8dfd; length=241; release=r1.3; species=Dsec;
Sequence
MQSSEGSPDMMDQKYNSVRLSPAASIPSTWIKKRAGPSPERQLPGSACSLLEESLDGVLH
PGPWAPVPLCPMNFRPSCCSSTSPKCQPGDHGHGNPAKVHAFQEVLNQLCHLNIDSTEYE
CLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSA
LHNYIQRTHPSQPMRFQTLLGVLQLMHKVSSFTIEELFFRKTIGDITIVRLISDMYSQRK
I
Download sequence
Identical sequences B4HZW0
XP_002037408.1.34323 FBpp0194386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]