SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0195369 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0195369
Domain Number 1 Region: 451-545
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000189
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 557-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000174
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0195369   Gene: FBgn0168823   Transcript: FBtr0196877
Sequence length 615
Comment type=protein; loc=scaffold_2:complement(5744693..5744744,5746524..5746577,5747463..5747571,5747817..5747944,5748029..5748206,5771785..5773111); ID=FBpp0195369; name=Dsec\GM13892-PA; parent=FBgn0168823,FBtr0196877; dbxref=FlyBase:FBpp0195369,FlyBase_Annotation_IDs:GM13892-PA,GB_protein:EDW50618,REFSEQ:XP_002035482,FlyMine:FBpp0195369; MD5=9fb096738fc9a28ad452865c22451995; length=615; release=r1.3; species=Dsec;
Sequence
MYAQHLRKWSLKTKKQLMPLILLIISYMLLLNTCVLSSSATTQQQQQQQKHLSRLWEGSA
EESSYYIPLSSDNGSGSSESSAESGSSSSRSSSNIDNNILSRLLSLNSNSLSSRSNVKLK
PATVFDAGSSTPAQQEQHVAAVPEQQQQQQQSMQKVPNTLINSQIYNLLYNGMPSEAASS
KMRRHIQPSQLPHQPESIAQLPSNYSIRPAVRSYLIESYEMPESQLEDRSPEQAARSRRD
GSNTNGSRQQQRTGHRQQMQQDKRDHRRQRQDQQKEQRQQQQHQHQSGNKHHQQQQQRRK
HQRKHQRYNRYCSARDPAQLAFAAPTVFQGVFKSMSADRRVNFSATMKVEKVYKQQHDLQ
LPTLVRLQFALSNSTGECDIYRERLMPRGMLRSGNDLQQASDISYMMFVQQTNPGNFTIL
GQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEVSGQPPPKV
TWFKDDKSINRKRNIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKNKASKAIAKRRIMI
KASPVHFPTDRSASGIPCNFDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCENKWPDSRY
FVAIYGQIHTLNNDY
Download sequence
Identical sequences B4HUJ7
XP_002035482.1.34323 FBpp0195369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]