SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0195685 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0195685
Domain Number 1 Region: 36-271
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-30
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 2 Region: 401-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000305
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000329
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0195685
Domain Number - Region: 371-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000671
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0195685   Gene: FBgn0169134   Transcript: FBtr0197193
Sequence length 644
Comment type=protein; loc=scaffold_2:complement(1537870..1537971,1538030..1538363,1538431..1539835,1543395..1543488); ID=FBpp0195685; name=Dsec\GM14208-PA; parent=FBgn0169134,FBtr0197193; dbxref=FlyBase:FBpp0195685,FlyBase_Annotation_IDs:GM14208-PA,GB_protein:EDW50057,REFSEQ:XP_002034921,FlyMine:FBpp0195685; MD5=51b43a205d321999c9e44907dbb71d2f; length=644; release=r1.3; species=Dsec;
Sequence
MIRIRFGMDVLLVLLLATCLLTPAHGTPLEWDFAVTLRTKIQFMDSSWQTIATAAHEFDE
LSALTFDESEELIYFNDLKHRNGSIFSLKRDLVAANHVAEQTIARTGNESVGGLAYDPLN
MNLFWSDTEQRKIFFAPIYGSATPKVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPT
VERINLDGSNRTVIINSDIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESCKLDGSDRQVV
LKDKHHEPLNLAVTNDAIYWTDRTTRAVWSHPKVPVIKVTTTSKPEEEDSTDSTDFTDPE
PMAEDCPLVRVANLSEEARGIVVRTGFYQRLQKDHHCASIVRKVKERVVEQNRKFEIRSM
LDQKIKVLEDERCMNGGEYRAATDLCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPK
CYCQPGFTGERCELSVCSGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICSL
FCRLLKHEPEMYVPFGCHSICEELAQDNSTYIAVPQYEHLEVCLTPRVWTSSVIIILVVG
IVSSLLLVAVIVHGIRRLYKPKRPRIRKTFVVRKQARTNSAGDTPLTNRPLATEQCEITI
ENCCNMNICETPCFDPKLVEQTLSKSSCKEDKKILIHNMEDDLY
Download sequence
Identical sequences B4HVU2
XP_002034921.1.34323 FBpp0195685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]