SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0196691 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0196691
Domain Number 1 Region: 575-769
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-70
Family Sec7 domain 0.00000213
Further Details:      
 
Domain Number 2 Region: 91-161,339-540,1005-1392,1543-1635
Classification Level Classification E-value
Superfamily ARM repeat 2.88e-22
Family Plakophilin 1 helical region 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0196691   Gene: FBgn0170134   Transcript: FBtr0198199
Sequence length 1653
Comment type=protein; loc=scaffold_3:join(59474..60254,60526..64568,64638..64775); ID=FBpp0196691; name=Dsec\GM15214-PA; parent=FBgn0170134,FBtr0198199; dbxref=FlyBase:FBpp0196691,FlyBase_Annotation_IDs:GM15214-PA,GB_protein:EDW51674,REFSEQ:XP_002035751,FlyMine:FBpp0196691; MD5=9e155d979bad796dda105b5c9ea74b20; length=1653; release=r1.3; species=Dsec;
Sequence
MHNNSTKTKEMFIVRALEKILADKDIRRSHHSQLKKSCDSALEQIKAELISAGQIAEGNE
LPCAALPLPKNDAASIINAETYFLPFELACKSRSPRIVVTALDCLQKLIAYGHLTGSIQD
SANPGHLLIDRIVVTIYGCFSGPQTDEAVQLQIIKALLTVVTSQHVEIHEFTLLQAVRTC
YDIYLSSKNLVNQTTARATLTQMLNVIFARMENQVYELPPPNSNPINGSIHSEDCNGSGE
ESQRDSDEVIASELLAEIISAAYNEAMKDQESVGEPEPTLNGNDYSSHSDHDSVELHSEN
DAVVTAKFTHILQKDAFLVFRALCKLSMKPLPDGHPDPKSHELRSKVLSLHLLLLILQNA
GPVFRSNEMFIMAIKQYLCVALSNNGVSLVPEVFELSLSIFVALLSNFKVHLKRQIEVFF
KEIFLNILEANSSSFEHKWMVIQALTRICADAQSVVDIYVNYDCDFSAANLFERLVNDLS
KIAQGRQALELGANPMQEKSMRIRGLECLVSILKCMVEWSKDLYVNPNMPVPPMQVQSPT
STEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEERKMRKEVMETGIELFNRKPQKG
VQFLQEKQLLGAKCEDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFRQME
VVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTT
DLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNSGMLQQAK
PTGKQAFITEKRRKLLWNMEMEVISLTATNLMQSVSHVKSPFTSAKHLEHVRPMFKMAWT
PFLAAFSVGLQDCDDPEIATLCLDGIRCAIRIACIFHMSLERDAYVQALARFTLLNANSP
INEMKAKNIDTIKTLIMVAHTDGNYLGSSWLDIVKCISQLELAQLIGTGVRPQFLSGAQT
TLKDSLNPSVKEHIGETSSQSVVVAVDRIFTGSMRLDGDAIVDFVKALCQVSVDELQQQQ
PRMFSLQKIVEISYYNMERIRLQWSRIWQVLGEHFNAVGCNSNEEISFFALDSLRQLSMK
FMEKGEFSNFRFQKDFLRPFEHIMKKNASPAIRDMVVRCIAQMVNSQAHNIRSGWKNIFS
IFHLAAGDNEEPIVELAFQTTGKIIGDLYKRQFAIMVDSFQDAVKCLSEFATARFPDTSM
EAIRLVRTCAQCVHEAPQLFAEHAGMENDASVAEEDRVWVRGWFPMLFSLSCVVNRCKLD
VRTRALTVLFEIVKTYGESFKPHWWKDLFNVIFRIFDNMKLPEHVTEKSEWMTTTCNHAL
YAIIDVFTQYFDVLGHLLLEELFAQLHWCVQQSNEQLARSGTNCLENLVISNGFKFNEST
WDKTCQCILDIFNATLPQDLLSWRPKAHSSNNIPQEHNHFEALHIRCVVQLELIQTMDNI
VFFPATSRKEDAETLAQAAADLTGGRSGSQSQLLECQREEQGMYGYLRTRQLLTLADCLM
QSHRFAKRFNADHDQRSLLWRAGFKGSVKPNLLKQETSSLACVLRIFFKMYGDENRRSDW
PGIEQELVQVCKEALGYYLSLQSEAHRDAWTSLLLLILTRLLKMSDARFATHVSNYYSLL
CEMMCFDLKPELRSVLRRVFMRIGPVFNIMSVK
Download sequence
Identical sequences B4HX94
XP_002035751.1.34323 FBpp0196691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]