SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0196889 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0196889
Domain Number 1 Region: 336-621
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.14e-44
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 161-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 243-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000417
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 68-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 122-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0196889   Gene: FBgn0170330   Transcript: FBtr0198397
Sequence length 628
Comment type=protein; loc=scaffold_12:join(1666069..1666135,1666726..1667029,1667106..1667587,1667655..1667958,1668011..1668232,1668290..1668797); ID=FBpp0196889; name=Dsec\GM15412-PA; parent=FBgn0170330,FBtr0198397; dbxref=FlyBase:FBpp0196889,FlyBase_Annotation_IDs:GM15412-PA,GB_protein:EDW44824,REFSEQ:XP_002041176,FlyMine:FBpp0196889; MD5=4ad4cf7d4c4e790e7562be0e094449d8; length=628; release=r1.3; species=Dsec;
Sequence
MQLISFLSNPLFLCALLLRFRTIFAACDSSQFECDNGSCISQYDVCNGEKNCPDGSDETA
LTCVSQRQHCTKPYFQCTYGACVIGTAGCNGVNECADGSDETRLRCGNEDDIRQHDRRLQ
GNCQENEFKCPSGICLDKSNFLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTGGCI
SGSLSCNGENDCYDGSDEAPLLCNTTKKVTTPVVTETPLELLGCPLPLGDERPILTGDGS
RVLTGPITRGTVRFSCKQGYVLEGEESSYCAKKKWSTSTIPKCVKYCSTAGEFDGYSTKA
LCTHNGQQVDCRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQ
LATPIKSFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEG
TRLPYSYDTFRVIAAKFYRNYGETSPDEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDE
PFELSHVIRPICVTFASFAEKESVTDEVQGKFAGWNIENKHELQFVPAVSKSNSVCRQNL
RDIQADKFCIFTQGKSLACQGDSGGGFTSELSTNAFSTWNNPRHFLFGVISNAPNADQCA
HSLTVMTNIQHFEDMILNAMNRSVETRS
Download sequence
Identical sequences B4IBR6
FBpp0196889 XP_002041176.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]