SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0196997 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0196997
Domain Number 1 Region: 1208-1317
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000175
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0196997   Gene: FBgn0170438   Transcript: FBtr0198505
Sequence length 1322
Comment type=protein; loc=scaffold_9:complement(2857579..2858205,2858259..2859122,2859301..2859489,2859548..2860423,2861954..2862936,2863113..2863542); ID=FBpp0196997; name=Dsec\GM15520-PA; parent=FBgn0170438,FBtr0198505; dbxref=FlyBase:FBpp0196997,FlyBase_Annotation_IDs:GM15520-PA,GB_protein:EDW56992,REFSEQ:XP_002040127,FlyMine:FBpp0196997; MD5=844b7ddf2947f7ce58dfa13b7a2a1f1f; length=1322; release=r1.3; species=Dsec;
Sequence
MLSYEPIAYKPSAPVLSNISEQESAVEEVQEKEELATEPPSRRSSRSRRSSGAGGRLLQK
RLSQGQVSFKARDSQLPPPKPPRRSSQSLDGKLSQSSLTSTNPSVREAERVLDEFLRKRG
VQVPTSNLEPSRKKDSKRRSFPMAEVEKPRHPRSQKQLPTCPSLSDIERVVESKRGSNYA
RNIRQESSRKGPHTKEVIIGWTEPKITDMLNYEGKTASDFRTPAEPQVAIGWQLPKAQPQ
PVVPKVSLDTVDGSVFENLASNMVHKETPIKYSSRVSTAGGQASQKFIWGEQWRNLSPWK
GNKPKNLGKKSKNFLNNSKKKILRFVSPKKSNQEDHTQLDQQRFTPQQCTIGVQTSTSQL
DLQSQSPPGSYHSPMQTTPSATTTSTRQQLDTEQPYFDFERKVKAPTPPKKLPRANRARK
LDFQAAAAPTTYRSYHKDLDQDVTITKMGYLLSSIRAKLEASDEQAVRTFQNCSRRFDRH
EPQISHLQTESYDCTDGPSSGATTSLATTRQQRDLDSEPIYSEIEEDCLLIRGSPHHEVR
TAAQIIDHTRTPTESSTAYVSESVPAPSPSRDDISAMYARVQKTPKNSPQMKPLVKPQIS
FQAIQPQKSTHSASPPITTPIALDQEVQPKSCTQSNPPQLSTQMVSPQATAPQQPVALGH
FLHESLKNGNFFQFMPLPEEPSGTESSCSASQTTESSVVRQPKLKLPPPHTHQSLNNISE
QHSPPKQNRNLSRSELSLQRSEIFLDNLCRSELVLDRLEKVPNNTSNVDSVSYDMPEQLY
ADYSLVGAGSAGSSFVTNDYGSGQIEPEPANQSTPKKKQSQRFTTKPASNLTIEIHDGQA
TSLRHLGNNLSISCPTTPQQAEASQAVDPSVLHNSSSLGELMQTVPNPSDSQLMSVSALA
RYRLLKNALRRSYRKGKDFFLAEKQRLAQSLNLSRDQSNQTDGELDSSTYYASFNVDSLL
NDSLNPNEQLAQAVSICRQMPELEISAEMVEAERLLLFSTLRKSTPLGGQLNEEALAARR
KSQCLLIDTMELPVRADVSRDMFFNYHYICTFECGGRIRSTQSVECQNGSAFFRDCGLEF
YSGENADSLELRCQIFMLRLRKVSTLALEPAKSLRRGSGNLGSANSSGSAGSGGEQIMSR
FRLHASFHLRAVDLSPFQLVTNESRSSDKICLRSSRSWQVPLSTHTKSTNLGPAISITGR
VDLRLHKTRFSGYLNVQDPKSQHNWNRRWCSLDGVRLSVWQHEDNLESDTPIFSLELPGL
GQSQIAAAPRELCARARSFLLQGRESDYESGVFFAADTQAELSEWLTHLNEAIAFARHWL
CS
Download sequence
Identical sequences B4I8R7
XP_002040127.1.34323 FBpp0196997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]