SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0197769 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0197769
Domain Number 1 Region: 2764-2850
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 1915-1974
Classification Level Classification E-value
Superfamily BPTI-like 7.24e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 3 Region: 1844-1899
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 2530-2613
Classification Level Classification E-value
Superfamily Immunoglobulin 4.2e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 1998-2051
Classification Level Classification E-value
Superfamily BPTI-like 4.4e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 6 Region: 2124-2180
Classification Level Classification E-value
Superfamily BPTI-like 1.05e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0049
Further Details:      
 
Domain Number 7 Region: 1607-1662
Classification Level Classification E-value
Superfamily BPTI-like 1.12e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 8 Region: 1785-1841
Classification Level Classification E-value
Superfamily BPTI-like 1.84e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 9 Region: 1728-1781
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 10 Region: 1666-1721
Classification Level Classification E-value
Superfamily BPTI-like 2.98e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 11 Region: 2314-2373
Classification Level Classification E-value
Superfamily BPTI-like 5.53e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 12 Region: 2191-2246
Classification Level Classification E-value
Superfamily BPTI-like 6.24e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.005
Further Details:      
 
Domain Number 13 Region: 2251-2304
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 14 Region: 2067-2122
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000199
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0034
Further Details:      
 
Domain Number 15 Region: 2626-2705
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000267
Family I set domains 0.012
Further Details:      
 
Domain Number 16 Region: 338-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000798
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 17 Region: 460-520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 18 Region: 2451-2497
Classification Level Classification E-value
Superfamily Elafin-like 0.000000085
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 19 Region: 58-110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000102
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 20 Region: 638-688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000445
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 21 Region: 579-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 399-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 23 Region: 524-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000366
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0197769   Gene: FBgn0171208   Transcript: FBtr0199277
Sequence length 2898
Comment type=protein; loc=scaffold_22:complement(950131..950300,950359..950475,950535..950693,950806..951222,951473..951623,951686..952251,952519..952689,952772..952966,953026..953209,953266..954302,954409..954579,954863..955042,955102..958684,958741..959044,959103..960131,960272..960450,960510..960570,968809..968831); ID=FBpp0197769; name=Dsec\GM16292-PA; parent=FBgn0171208,FBtr0199277; dbxref=FlyBase:FBpp0197769,FlyBase_Annotation_IDs:GM16292-PA,GB_protein:EDW49130,REFSEQ:XP_002043022,FlyMine:FBpp0197769; MD5=39dc7ed97a81fbf3c1674cfdc42b811b; length=2898; release=r1.3; species=Dsec;
Sequence
MDLSRRLCSTALVAFIVLAGIHDSQSRFPGLRQKRQYGANMYLPESSVTPGGEGNDPDEW
TPWSSPSDCSRTCGGGVSYQTRECLRRDDRGEAVCSGGSRRYFSCNTQDCPEEESDFRAQ
QCSRFDRQQFDGVFYEWVPYTNAPNPCELNCMPKGERFYYRQREKVVDGTRCNDKELDVC
VNGECMPVGCDMMLGSDAKEDKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGAT
NIRIEETVPSSNYLACRNHSGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQLT
CSGPISESLFIVMLVQEKNISLDYEYSIPESLSQSQQDTHTWTHHQFNACSASCGGGTQS
RKVTCNNRITLAEVNPSLCDQKSKPVEEQACGTEPCAPHWVEGEWSKCSKGCGSDGFQNR
SITCERISSSGEHTVEEDAVCLKEVGNKPATKQECNRDVKNCPKYHLGPWTPCDKLCGDG
KQTRKVTCFIEENGHKRVLPEEDCVEEKPETEKSCLLTPCEGVDWIISQWSGCNACGQNT
ETRTAICGNKEGKVYPEEFCEPEVPTLSRPCKSPKCEAQWFSSEWSKCSAPCGKGVKSRI
VICGEFDGKTVTPADDDSKCNKETKPESEQDCEGEEKVCPGEWFTGPWGECSKPCDGGER
VREVLCLSNGTKSVNCDEEKVEPLSETCNSEACIEDEILPFTSDDKPIEDDEEDCEEDGI
ELISDGLSDDEKSEDVIDLEGTAKTETTPEDEELMQSDSPTPFDEFESTGTTFEGSGYDS
ESTTDSGISTEGSGDDEETSEASTDLSSSTDSESTSSESSSSDSSSSISSDATSEAPASS
VSDSSDSTDASTETTGISEVSTDVSSSTETSASESTDFSGASDSTDSTNASDSTSESTTE
ASSSTDDSTDSSDNSSNVSESSTEASSSSVSDSSASTDGSTDGASSTTENSSDSTSDAPS
DSTASSDSTDSTSDQTTETTPESSTDSTESSTLDASSTTDASSTIESSTESSTDGSSSTS
DSESTETTGLSSDGSTTDATTATSDSSDSTTDGSTDQSTDGSSNASTDGSTEGASEETTL
STESSGSTESTDANASDGSTTEGSTVDDLSSSTSSDVTSDSTTDSSSSTEVSGSTDSSSS
TDGSSTDASSTEASSTDVTESTDSTVSGGTSDTTESGPTEESTTEGSTESTTEGSTESTQ
STDLDSTTSDIWSTSDKDEESESSTPYSFDSEVTKSKPRKCKPKKSNCAASKYGCCPDGK
STPKGPFDEGCPIAKTCADTKYGCCLDGVSPAKGKNNKGCPKSQCAETLFGCCPDKFTAA
DGENDEGCPKTTTVPPTTTTEESQPETTTEIEGSDQDSTTLEPDTKKSCSFSEFGCCPDA
ETSAKGPDFEGCGVASSVAKGCAESENGCCPDGQTPASGPNGEGCSGCTRERFGCCPDSE
TPAHGPNKEGCCLDTEFGCCPDNILAARGPNNEGCECHYTPYGCCPDNKSAATGYNQEGC
ACETTQYGCCPDKITAAKGPKHEGCPCEATQFGCCPDGLTFAKGPHHHGCHCTQTEFKCC
DDEKTPAKGPNGEGCTCVESKFGCCPDGVTKATDEKFGGCENVQEPPQKACGLPKETGTC
NNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQEYTGKHVCLLPKSAGPCT
GFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGSCAASENLPTCEQPVESGPCAG
NFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKDRCAIPKQTGDCSE
KLAKWHFSENEKRCVPFYYTGCGGNKNNFPTLESCEDHCPRQVAKDICEIPAEVGECANY
VTSWYYDTQDQACRQFYYGGCGGNENRFSTKESCLARCDRKPEPTTTTPAPRQQASSQAV
CDEEPAPGECSNWVLKWHFDRKVGACRQFYYGNCGGNGNRFETENDCQQRCLSQQPPAPT
PPRAPAPTRQPDPAPTVPQCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRF
ATEEECSARCSVNIDTRIDADPVEHDTSKCFLAFESGNCYDNVTRWFYNSAEGLCDEFVY
TGCGGNANNYATEEECQNECNDAQTTCALPPVRGRCSELSRRWYFDERSGECHEFEFTGC
RGNRNNFVSQSDCLNFCIGLTVVEEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENMACT
AFTYTGCGGNGNRFETRDQCERQCGEFMGVDVCNEPVTTGPCTDWQTKYYFNTASQACEP
FTYGGCDGTGNRFSDLFECQTVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRWYYD
DAAGNCISFIYAGCSGNQNNFRSFEACTNQCRPEPNKQDNEIGQNPCDTFDAECQELRCP
YGVRRVAARSQPECTQCICENPCEGYSCPEGQQCAIDVASSDDRQFAPVCRDIYKPGECP
TLSANASGCARECYTDADCRGDNKCCSDGCGQLCVHPARPTQPPRTQAPVVSYPGDARAA
LEPKEAHELDVQTAIGGIAVLRCFATGNPAPNITWSLKNLVINTNKGRYVLTANGDLTIV
QVRQTDDGTYVCVASNGLGEPVRREVALQVTEPVSQPAYIYGNKNVTQIVELNRPAVIRC
PAGGFPEPHVSWWRNGQMFGLKNNLMTRDYSLVFNSIQLSDLGLYTCEVYNQRRPVSLRV
TLKAVGPVRPLSPEEEQYMQYVLNPATRPVTQRPSYPYRPTRPAYVPEPTVNVHAVLALD
PKNSYTPGSTIVMSCSVQGYPEPNVTWTKDNVPLYDNERVQITYQPHRLVLSDVTPADSG
KYTCRASNAYTYANSEANVSIQSVVPVSPECVDNPYFANCKLIVKGRYCSNPYYTKFCCR
SCTLAGQVATPPLHPNAV
Download sequence
Identical sequences B4IH12
FBpp0197769 XP_002043022.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]