SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0197814 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0197814
Domain Number 1 Region: 33-109
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.75e-17
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 2 Region: 706-795
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.49e-17
Family Thyroglobulin type-1 domain 0.0022
Further Details:      
 
Domain Number 3 Region: 396-470,575-603
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000046
Family Thyroglobulin type-1 domain 0.0059
Further Details:      
 
Domain Number 4 Region: 140-248
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000602
Family Thyroglobulin type-1 domain 0.0024
Further Details:      
 
Domain Number 5 Region: 959-1078
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000144
Family Thyroglobulin type-1 domain 0.0038
Further Details:      
 
Domain Number 6 Region: 1161-1217
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000772
Family Thyroglobulin type-1 domain 0.0019
Further Details:      
 
Domain Number 7 Region: 671-720
Classification Level Classification E-value
Superfamily Elafin-like 0.000000249
Family Elafin-like 0.0014
Further Details:      
 
Domain Number 8 Region: 257-292
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00000223
Family Huristasin-like 0.0074
Further Details:      
 
Domain Number 9 Region: 796-830
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00000258
Family Huristasin-like 0.0096
Further Details:      
 
Weak hits

Sequence:  FBpp0197814
Domain Number - Region: 906-976
Classification Level Classification E-value
Superfamily BPTI-like 0.000192
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.023
Further Details:      
 
Domain Number - Region: 599-639
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00558
Family Huristasin-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0197814   Gene: FBgn0171252   Transcript: FBtr0199322
Sequence length 1401
Comment type=protein; loc=scaffold_22:complement(46018..47297,47366..49021,49081..49519,49582..50030,50361..50645,52695..52791); ID=FBpp0197814; name=Dsec\GM16337-PA; parent=FBgn0171252,FBtr0199322; dbxref=FlyBase:FBpp0197814,FlyBase_Annotation_IDs:GM16337-PA,GB_protein:EDW49055,REFSEQ:XP_002042947,FlyMine:FBpp0197814; MD5=7c07c449466934d6de9b95a86b71b62a; length=1401; release=r1.3; species=Dsec;
Sequence
MAHYDQRWLKLFSGCLFLLLLALQVSEAKRSNANLTACQHLRRSESRRAKSLEGSSVRVP
RCQKNGDFDAIQCQDEKAGRDCWCVDDYGVELPGSRNETRSGVVCAEPRHCAASACRMFC
PSRGVMNPPDHSQYTERTGYMCGSPCSHDLECRNLEKCCFTKGCQFNCQQPGNVTGCHQA
KALADILSINEREGRGYVPECNGPGGQFSPRQCSRNGLVCWCVDPRTGHKIKETMGAANN
VNCDGWENMISRSYARSFQMEQCDTNICAAVCEYGFKNDHNGCPTCECSEPCDGFKCSIG
SHCEVATDPLCESGSSLCASWPVCKPDLVYSNPCDVGTPLSDPATGEVMYCFEDRQGRSF
QPTAFFEPEPEALSKQGRSMSNRIMCPEQYKCTKLHRETENVCCPVPEKPNPAEEATGTH
QQTMCEYLRDFSERMEGTEEGMQLAVPSPRCTTDGDYEGRQCQLKKVRVTRAEQRKILEE
NTIRRMRMLLASAAPSVSKRSRRDLERLKLYRVDDSALKVQVAAPVMGRSAKVIDMGADR
QQGLGQLFETEFKKVASASKRQPENENELVEMEVEQCWCVDSFGTEIPRSRGFNVTEDTC
RSLREDLDCLDLTCRMGCEYGFSLDPDTRCPACQCRDPCEGVTCGSGKECRVVDVSCEGE
YCPPVPACLPRKPGQCPYLVPPGPDNLDANTCAYECRTDAHCEGARRCCSNGCGTQCVDP
QLKTACQHLQAIQLHQSSELGIPARQMAVAQCDPNNGKWNQVQCSPDGHCWCVDDQGKIL
PGTRVKSPATPKCQENSSFACPKTNCSLECESGYQMDSNGCPTCECRNYCNEVSCSPHEE
CQLISVECVDSPCPKMPICVPRRASICPEGNPLQQGDLDMSCGPHNEHEVCPTTHSCQLN
PVNNRGVCCSKTRDVCFESMDNGCLATGKSERNSTRYRFSPKANKCLPVVTDSEAPACQT
KNLFHNELACNSVCPVLTQCERLKLKNNLAAQRTGHSSVWFQPRCDPVTGHWSPVQCLGK
QPQPMDRHTEIVSRAFASEPVASAGEEAPGVCWCADKKGAPLKGTLTRESEPICNSRQAR
NRKAFDSGDPLMEQLIAQLTQLNDVASEDLDFDEVEARVLPATASAAESSVTETVLELAN
SLLDSQLSVEQATLKPMELKTTRCRALANTAPFPVSCDEAGAFRPLQCNGRSCWCVDAAG
NQLQSTHVFGAGDRRCSHVPIESVAIELHLTNSSGQSVRNAYDTIRRELQQLLGGESVEN
LRVQENFDGSAIVRFELHNEAKVDLAFAIEAAISAGDFRLAGGHFRPDLTRSHFVHRSAH
VPVAQAATAQDESIQLVLFIMATSSAFLVSIFVVYVMLKRNRNLKSANPYLKGEGGDKPV
DYSAPIFVLAADMDSKKGFAA
Download sequence
Identical sequences B4IGT7
FBpp0197814 XP_002042947.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]