SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0199250 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0199250
Domain Number 1 Region: 152-320
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-37
Family Phosphotyrosine-binding domain (PTB) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0199250   Gene: FBgn0172681   Transcript: FBtr0200758
Sequence length 328
Comment type=protein; loc=scaffold_33:join(11721..11778,11925..12382,12444..12680,12736..12867,12923..13024); ID=FBpp0199250; name=Dsec\GM17773-PA; parent=FBgn0172681,FBtr0200758; dbxref=FlyBase:FBpp0199250,FlyBase_Annotation_IDs:GM17773-PA,GB_protein:EDW51111,REFSEQ:XP_002043830,FlyMine:FBpp0199250; MD5=9bdc4eb8e36766e623a7aebdedc47c5b; length=328; release=r1.3; species=Dsec;
Sequence
MKTKKFIDYFCIFYLLSNNLEEYVADIPFAGLFKGSTLNLSSDVVDGIGAVPGDREFLQS
PSMVRSAHVQNHRRSLSKQRYSALGEDFSASRVWAEIDTIFENIGNEVSTVEQEVEELVE
DPASLSLADSRQSLHIRDPAELLLGRKPSAASSNWCHSPYTLIYGEIRYSLFYLGSTVIR
KLQGTLSTRKSIQKLKIDENLKSAASVSDFSLLENCTTSTKYLKAANHQTRLNVDIAVSC
VGVKFIDHEKKTAICCHDIENINCVSQDSEDLRYFAYITKEQDLHYCHVFMVDSLELAKE
IIMTLGQAFEVAYQLALSRQGTSLNEEC
Download sequence
Identical sequences B4IJC0
XP_002043830.1.34323 FBpp0199250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]