SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0199263 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0199263
Domain Number 1 Region: 487-718
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-47
Family Nuclear receptor ligand-binding domain 0.0007
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-27
Family Nuclear receptor 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0199263   Gene: FBgn0172693   Transcript: FBtr0200771
Sequence length 722
Comment type=protein; loc=scaffold_33:join(113080..113746,113815..113871,113937..114757,115745..115954,116026..116238,116298..116498); ID=FBpp0199263; name=Dsec\GM17786-PA; parent=FBgn0172693,FBtr0200771; dbxref=FlyBase:FBpp0199263,FlyBase_Annotation_IDs:GM17786-PA,GB_protein:EDW51127,REFSEQ:XP_002043846,FlyMine:FBpp0199263; MD5=40959bcac0314b8aaff78087a9a73d2a; length=722; release=r1.3; species=Dsec;
Sequence
MSPPKNCAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQ
KCRLRKCLDIGMKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAP
ADSSSSNLDHYSGSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQMTAEKIVEQIVSDP
DRASQAINRLMRTQKEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNAL
TVFTKFMSSPTDGVEIISKIVDSPADVVEFMQNLMHSPEDAIDIMNKFMNTPAEALRILN
RILSGGGTNAAQQTADRKPLLDKEPAVKPPAPAERADTVIQSMLGNSPPISPHDAAGDLQ
YQSPVGEQPSTSSSHPLPYIANSPDFDLKTFMQTNYNDEPSLDSDFSINSIESVLSEVIR
IEYQAFNSIQQAASRVKEEMSYGTQSTYGGCNKASNNSQPHLQQPICATSTQQLDRELNE
AEQMKLRELRLASEALYDPVDEDLSVLMMGDDRIKPDDTRHNPKLLQLINLTAVAIKRLI
KMAKKITAFRDMCQEDQVALLKGGCTEMMIMRSVMIYDDNRAAWKVPHTKENMGNIRTDL
LKFAEGNIYEEHQKFITTFDEKWRMDENIILIMCAIVLFTSARSRVIHKDVIRLEQNSYY
YLLRRYLESVYSGCEARNAFIKLIQKISDVERLNKFIINVYLNVNPSQVEPLLREIFDLK
NH
Download sequence
Identical sequences B4IJD6
XP_002043846.1.34323 FBpp0199263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]