SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0199446 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0199446
Domain Number 1 Region: 47-171
Classification Level Classification E-value
Superfamily PH domain-like 8.24e-40
Family GRAM domain 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0199446   Gene: FBgn0172876   Transcript: FBtr0200954
Sequence length 189
Comment type=protein; loc=scaffold_5:complement(4107102..4107671); ID=FBpp0199446; name=Dsec\GM17969-PA; parent=FBgn0172876,FBtr0200954; dbxref=FlyBase:FBpp0199446,FlyBase_Annotation_IDs:GM17969-PA,GB_protein:EDW54454,REFSEQ:XP_002038036,FlyMine:FBpp0199446; MD5=4de7f8cf484272ff3c1230a35546ec9e; length=189; release=r1.3; species=Dsec;
Sequence
MDPSASLADKLASKTASSNSLDSSSKSSSLGSKHGGGENGIIRDTPFGYLEGEEDQDQKN
DVTYVCPYRGPVFGALTITNYRLYFRSLPLRDQEPPVVVDVPLGVIARVEKIGGATSRGE
NSYGIEIFCKDMRNLRFAHKQQNHSRRTVFEKLQANAFPLSYSGRLFAFAHAAANSVNGN
GGWDGLGGI
Download sequence
Identical sequences B4I1P7
FBpp0199446 XP_002038036.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]