SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0200057 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0200057
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-53
Family Nuclear receptor ligand-binding domain 0.0000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0200057   Gene: FBgn0173486   Transcript: FBtr0201565
Sequence length 196
Comment type=protein; loc=scaffold_5:join(4008028..4008135,4008232..4008714); ID=FBpp0200057; name=Dsec\GM18580-PA; parent=FBgn0173486,FBtr0201565; dbxref=FlyBase:FBpp0200057,FlyBase_Annotation_IDs:GM18580-PA,GB_protein:EDW54428,REFSEQ:XP_002038010,FlyMine:FBpp0200057; MD5=736306019ba166057619c36965465b2f; length=196; release=r1.3; species=Dsec;
Sequence
MLQETTARLLFMAVRWVKCLMPFQTLSKNDQHLLLQESWKELFLLNLAQWTIPLDLTPIL
ESPLIRERVLQDEATQTEMKTIQEILCRFRQITPDGSEVGCMKAIALFAPETAGLCDVQP
VEMLQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRTIRAATIEALFFKETIGNVPIA
RLLRDMYTMEPAQVDK
Download sequence
Identical sequences B4I1M1
XP_002038010.1.34323 FBpp0200057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]