SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0200404 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0200404
Domain Number 1 Region: 237-495
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.15e-67
Family Nuclear receptor ligand-binding domain 0.000000000147
Further Details:      
 
Domain Number 2 Region: 99-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-29
Family Nuclear receptor 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0200404   Gene: FBgn0173830   Transcript: FBtr0201912
Sequence length 505
Comment type=protein; loc=scaffold_10:complement(1718369..1719886); ID=FBpp0200404; name=Dsec\GM18927-PA; parent=FBgn0173830,FBtr0201912; dbxref=FlyBase:FBpp0200404,FlyBase_Annotation_IDs:GM18927-PA,GB_protein:EDW43909,REFSEQ:XP_002040438,FlyMine:FBpp0200404; MD5=386fa72863c97b2c868e87f34ae31591; length=505; release=r1.3; species=Dsec;
Sequence
MDNCDQDASFRLSHIKEEVKPDISQLNDSNNSSFSPKAESPVPFMQAMSMVHVLPGSNSA
SSNNNSAGDAQMAQAPNSAAAAAVQQQYPPNHPLSGSKHLCSICGDRASGKHYGVYSCEG
CKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEERQRGAR
NAAGRLSASGGGSSGPGSVGGSTSGGGGGGGGVSGGMGSGNGSDDFMTNSVSRDFSIERI
IEAEQRAETQCGDRALTFLRVGPYSTVQPDYKGAVSALCQVVNKQLFQMVEYARMMPHFA
QVPLDDQVILLKAAWIELLIANVAWCSIVSLDDGGAGGGGGGLGHDGSFERRSPGLQPQQ
LFLNQSFSYHRNSAIKAGVSAIFDRILSELSVKMKRLNLDRRELSCLKAIILYNPDIRGI
KSRAEIEMCREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLKCQDHLFLFRITS
DRPLEELFLEQLEAPPPPGLAMKLE
Download sequence
Identical sequences B4I9M8
FBpp0200404 XP_002040438.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]