SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0200663 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0200663
Domain Number 1 Region: 90-230,260-355
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.27e-34
Family Nuclear receptor ligand-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0200663   Gene: FBgn0174088   Transcript: FBtr0202171
Sequence length 366
Comment type=protein; loc=scaffold_10:join(1680878..1681775,1681848..1681969,1682076..1682156); ID=FBpp0200663; name=Dsec\GM19186-PA; parent=FBgn0174088,FBtr0202171; dbxref=FlyBase:FBpp0200663,FlyBase_Annotation_IDs:GM19186-PA,GB_protein:EDW43904,REFSEQ:XP_002040433,FlyMine:FBpp0200663; MD5=a668ce264def7375e4bab470fbf1c23b; length=366; release=r1.3; species=Dsec;
Sequence
MHSPAQQQQQQQQQQASPHLSLSSPHQQQQQGQHQNHHQQPGAGGGGAGGGAQLPPHLVN
GTILKTALTNPSEIVHLRHRLDSAVSSSKDRQISYEHALGMIQTLIDCDAMEDIATLPHF
SEFLEDKSEISEKLCNIGDSIVHKLVSWTKKLPFYLEIPVEIHTKLLTDKWHEILILTTA
AYQALHGKRRGEGGGSRHGSPASTPLSTPTGTPLSTPIPSPAQPLHKDDPEFVSEVNSHL
STLQTCLTTLMGQPIAMEQLKLDVGHMVDKMTQITIMFRRIKLKMEEYVCLKVYILLNKA
EVELESIQERYVQVLRSYLQNSSPQNPQARLSELLSHIPEIQAAASLLLESKMFYVPFVL
NSASIR
Download sequence
Identical sequences B4I9M3
FBpp0200663 XP_002040433.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]