SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0201233 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0201233
Domain Number 1 Region: 1086-1301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-35
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 462-566
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 358-461
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-30
Family Cadherin 0.00082
Further Details:      
 
Domain Number 4 Region: 568-679
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.0004
Further Details:      
 
Domain Number 5 Region: 50-163
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-28
Family Cadherin 0.00063
Further Details:      
 
Domain Number 6 Region: 667-789
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 157-255
Classification Level Classification E-value
Superfamily Cadherin-like 5e-19
Family Cadherin 0.0021
Further Details:      
 
Domain Number 8 Region: 257-365
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 781-876
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000108
Family Cadherin 0.006
Further Details:      
 
Domain Number 10 Region: 1417-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1311-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000647
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 12 Region: 4-56
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000671
Family Cadherin 0.0096
Further Details:      
 
Domain Number 13 Region: 1347-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 1061-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000602
Family EGF-type module 0.026
Further Details:      
 
Domain Number 15 Region: 1389-1427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000862
Family EGF-type module 0.007
Further Details:      
 
Weak hits

Sequence:  FBpp0201233
Domain Number - Region: 1044-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0393
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0201233   Gene: FBgn0174655   Transcript: FBtr0202741
Sequence length 1638
Comment type=protein; loc=scaffold_29:656115..661031; ID=FBpp0201233; name=Dsec\GM19756-PA; parent=FBgn0174655,FBtr0202741; dbxref=FlyBase:FBpp0201233,FlyBase_Annotation_IDs:GM19756-PA,GB_protein:EDW49868,REFSEQ:XP_002043657,FlyMine:FBpp0201233; MD5=4e74cc51820646af338073fe71e15eb0; length=1638; release=r1.3; species=Dsec;
Sequence
MISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTF
YSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTS
LDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIERLSVFENALPGT
VLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATD
GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYL
SGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEVIITVNDIND
NTPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGI
IRLDKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILE
NATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFY
FLTIQAIDGGTPPLSNHAYVNISILDINDNSPKFLQNLYRINVNEDIFVGSKILDVKATD
EDSDVNGLVTYNIERGDNIGQFLIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRC
NSVPININILDTNDNAPIFSSANYSVVLQENRPLGYIFLTFKISDADETPNTTPYTFDIR
SGNEGGLFRLEQDGSLSTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQY
PPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFGLVSGPEDMYQSSKLFNISNN
TGKIYAISNLDIGLYKLNVSVSDGKFHVFSIVKINVELVTSDMLKESVVIRFSRISASEF
LLSHRKTFMRSIRNIMRCRQKDVILITLQSDHQKASQHAVGIRRVRSIDSDLNVVFAVRK
QQIIPDSDEFFTSDEIRQTLIDKKNEIENETNLVVDDVLPSTCQSNKNDCVHGKCKQILQ
ILKNNVTTTFTDVISFAAPSYIPVNTCVCRPGFDGKHCKETVNACSTDPCSPQRICMPSG
STLGYQCVCPKGFSGTFCERKSSKCSNESCDMGLFTAVSFGGKSYAHYKINKVKAKFTLE
NEFSYSLQIRTVQQTGTLLYASGKVDYNILEIINGAVQYRFDLGSGEGVISVSSINISDG
EWHQISLERSLNSAKVMVDNKHVSHGSAPGVNGILNIQSNDIFVGAEVRPHPSIIGYEDI
QRGFIGCMANIKIAKESLPLYISGGSTIAALKRFTNVEFKCDPSNVLVRLGICGSQPCAN
SGICKELDTDVFECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDYHGPNNYSCTCPIHLS
GKRCEYGKFCTPNPCKNGGICEEGDGISHCMCRGYTGPTCEIDVDECENQPCGNGATCIN
EPGSFRCICPSYLTGASCGDPLYSNSISTKLKNFSIEHISGIISGVAVVLVIISCVLCCV
VLKRSSSSKRRNRLEKDKNKPSYKEANLNSLVDKDNYCKPNVKLSNLEVNQRPISYTAVP
NDNRSNRNFVNNLDILRSYGSAGDELENVPFEYQKVNRNKQHVNINSCHSTDADNTYKQE
WCEQMHLRTFSENKLNNG
Download sequence
Identical sequences B4IIU7
FBpp0201233 XP_002043657.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]