SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0201590 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0201590
Domain Number 1 Region: 77-258,337-497
Classification Level Classification E-value
Superfamily L domain-like 3.5e-58
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 544-685,741-891
Classification Level Classification E-value
Superfamily L domain-like 4.42e-58
Family Ngr ectodomain-like 0.00000031
Further Details:      
 
Domain Number 3 Region: 1163-1351
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 4 Region: 1090-1136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000743
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 930-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000175
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 960-1094
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 7 Region: 1378-1419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000722
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0201590   Gene: FBgn0174996   Transcript: FBtr0203098
Sequence length 1506
Comment type=protein; loc=scaffold_1:complement(9255487..9255573,9255643..9255785,9256377..9256536,9256599..9258123,9258189..9258332,9258967..9259038,9259104..9259472,9260862..9260933,9261212..9261430,9261513..9261666,9261736..9261893,9263176..9263391,9264423..9264566,9264649..9264790,9266150..9266385,9267178..9267321,9267419..9267490,9267934..9268005,9268079..9268150,9272162..9272481); ID=FBpp0201590; name=Dsec\GM20113-PA; parent=FBgn0174996,FBtr0203098; dbxref=FlyBase:FBpp0201590,FlyBase_Annotation_IDs:GM20113-PA,GB_protein:EDW48041,REFSEQ:XP_002034028,FlyMine:FBpp0201590; MD5=f34aaf6daefd04030ebba37551b8fcca; length=1506; release=r1.3; species=Dsec;
Sequence
MAAPSRTTLMPPPFRLQLRLLILPILLLLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGI
HIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYET
DFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLD
ISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHN
IFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQ
EFKCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFI
TELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLG
SLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPF
ICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECR
MDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLV
KLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCV
MPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDL
PHSEFKCSSENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEI
EQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLN
NLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIAR
CAEPEQMKDKLILSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLC
QPGYHGKHCEFMIDACYGNPCRNNATCTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIK
CQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTHYSCDCQA
GFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSP
CQNHECKHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEA
NVTIVFSSAEQNGILMYDGQDAHLAVELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHA
VELLAIKKNFTLRVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLT
SFKGCMKEVWINHKLVDFGNAQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPV
DPCLENKCRRGSRCLPNSSARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQV
REYYTENDCRSRQPLKYAKCVGGCGNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCG
CTKKCY
Download sequence
Identical sequences B4HSG3
FBpp0201590 XP_002034028.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]