SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0202443 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0202443
Domain Number 1 Region: 1071-1198
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-19
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0202443   Gene: FBgn0175847   Transcript: FBtr0203951
Sequence length 1208
Comment type=protein; loc=scaffold_1:join(1141001..1141018,1141125..1141430,1141492..1141971,1142053..1142419,1142485..1142850,1142909..1143080,1143243..1143375,1143443..1143619,1143685..1143906,1143962..1144328,1144473..1144771,1144834..1145553); ID=FBpp0202443; name=Dsec\GM20966-PA; parent=FBgn0175847,FBtr0203951; dbxref=FlyBase:FBpp0202443,FlyBase_Annotation_IDs:GM20966-PA,GB_protein:EDW46786,REFSEQ:XP_002032773,FlyMine:FBpp0202443; MD5=3a553f3d8b013ad22a2cd5a49545e8c7; length=1208; release=r1.3; species=Dsec;
Sequence
MDPFTQHMLEKAEQRSRALGISNASKFPLAECSVPSSSASGGDAGVMAPRSRSPGGQSAG
SGGGKVVMLGKATLEASPAKPLRHYTAVNKENLDMGIEINITTDKPIGVQVEIQEQEVTD
DEDQAEGGALNPLLEAEPVNQPLARLRDTSRSRLQRMGALYSNTDDLSSPIHRTEGQFHV
TTGEEEDCGNRSSRQPKQRLGKLAALADTINQWEDDTSHHEVHRPLEAPPPKPHLSSRKA
EKGPAPLPPKKDEVDEAAKTKQLKWDPKEEVGPASKVEEAASTAKPPVPQKSTTVSQVAK
NFASSAPAPKPAPAPAVSVKSGLVSGRAALFENKGTGGQTQGLRNQKDPCELSLKERMKL
FETGNNKAMLPMAPIGSAPSITQIRAEEVKQHLAAVHPVTAAAATTVVAATKPKPESKLR
DKVAALVANAQSSAETRIKDIDRQRQEDMQIISNRFNKQKELFDIQPSDSSGAAQTRPPA
PAPSRVVRPMPPPPPPPIAGLSSGLASSKRRSPGDAPTTDEDSKRARKSHSDRLYPALSD
LDSSGDNCCAAETASATDDSHQLDEEETDSCMDDDQSQTEDSSAGMCNGSLGREIMSAVQ
RNEAEMQQQQAGKKTVRYADQDMYYDDSSLNSSQVSAGIDDYLDEALVEDYGSTQDDQSD
SGDEQNASRLSLGSKGTTASNSFSFRKNPASSCTPIEEHHEMEMDLQTPLLSGAQPVKSE
LSVNQDNDNLVTLVHTVSFYRRQQSANSSNSTPVRKICREQQVMRSALAGDCHAKHRLEY
DSPQQSDYVAGAVTDIADQTDEDDEEMQNAREVNDASQAQDKIKKLLSEVCKQQQVIGQA
SQALNLCAATVEFSGSTESVEGERYLLLATHRRQACLDEVQRLRVENSIRPVGAPKEKGL
LTVKDITIPLRQEYVRKMASNNINGHHLVCLLKYNEHVLATKTVPTMPGLLSVKFPDVLQ
LNNVYADFRITLEIYGMLAQRDQLPHELKYHINLNKKGGIKTPKKKGGENRLVMPPVQSP
AGPNVVRTPQLVQYGFAIFSLREIQRTTWTLTQVLGVSPLEGVVHMKVNCELSVSVEYKG
FLTMFEDISGFGAWHRRWCYLNGSVINYWKYPDDEKRKTPMGSIDLNSCTSQKVTTAPRD
ICARLNTMLLECERPALETDQESLIIVPNGRTTTVRHLLSADTKEEREEWCAHLNKALTL
LRAWGTTH
Download sequence
Identical sequences B4HR43
XP_002032773.1.34323 FBpp0202443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]