SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0202486 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0202486
Domain Number 1 Region: 456-580
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-26
Family Ran-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0202486   Gene: FBgn0175890   Transcript: FBtr0203994
Sequence length 581
Comment type=protein; loc=scaffold_1:join(1648568..1648793,1648850..1650030,1650092..1650430); ID=FBpp0202486; name=Dsec\GM21009-PA; parent=FBgn0175890,FBtr0203994; dbxref=FlyBase:FBpp0202486,FlyBase_Annotation_IDs:GM21009-PA,GB_protein:EDW46879,REFSEQ:XP_002032866,FlyMine:FBpp0202486; MD5=506037f13e43bab847ad65186d6a4636; length=581; release=r1.3; species=Dsec;
Sequence
MAGKRQATSNLNHENWDVEEEPEERGTFRTATEEELKTRVIKKARRKIAGGSSAAEEDGA
EEKTAQPKSVFSGFSGFGKPAASAAASSPFSFLANLPAPATTSSSEPKKSAFSFGFSPSS
SSADRPASTSIFGTASPSNTADRPASTSIFGTASTAPSPSPAKESTSTVDGAKPTTSIFG
NISSAKKERSEAKTPLASSSSTSLTSTIETSEYRECVADLNRSVMKFLQDQMCKSPYCIL
TPVFKTYDEHLKDLQDEESARTNSTKSKTAQARFEEPVAKVSRASSPPKAAATFTFGKPS
APIGASVSPLAKKPNCTITSGGTTTTTTTPLVSFGSTAASTAPVSSSSSIFSLTAKPTGE
AKSDGAPKSSIFSFGAKDTTTKKDEPNFSAPKTNGFSFGLKSNNDDKPSTSLFAGFGKAP
EGAGDGAKGFSFTNSATPFSLGNIHPPAEAAASAEEKEEDTPPKVEFKQVVEDDAVYSKR
CKVFIKKDKDFGDRGVGTLYLKPVKDSEKTQLLVRADTNLGNILVNLILSKGIPCQRMGK
NNVLMVCVPTPEDSKATSMLLRVKNGDEADDLLEKIKEHMK
Download sequence
Identical sequences B4HRJ7
XP_002032866.1.34323 FBpp0202486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]