SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0203613 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0203613
Domain Number 1 Region: 365-593
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-30
Family Nuclear receptor ligand-binding domain 0.0008
Further Details:      
 
Domain Number 2 Region: 48-126
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0203613   Gene: FBgn0177007   Transcript: FBtr0205121
Sequence length 601
Comment type=protein; loc=scaffold_11:complement(1407162..1408342,1408450..1408719,1409262..1409576,1409655..1409694); ID=FBpp0203613; name=Dsec\GM22136-PA; parent=FBgn0177007,FBtr0205121; dbxref=FlyBase:FBpp0203613,FlyBase_Annotation_IDs:GM22136-PA,GB_protein:EDW44367,REFSEQ:XP_002040814; MD5=9d6539e9e8348ea3a34ebaea9d67832d; length=601; release=r1.3; species=Dsec;
Sequence
MDGVKVETFIKSEENRAMPLIGGGSASGGTPLPGSGVGMGAGASATLSVELCLVCGDRAS
GRHYGAISCEGCKGFFKRSIRKQLGYQCRGAMNCEVTKHHRNRCQFCRLQKCLASGMRTV
QHERKPIVDRKEGIIAAAGGSSTSGGGNGSSTYLSGKSGYQQGRGKGHSVKAESAATPPV
HSAPATAFNLNENIFPMGLNFAELTQTLMFATQQQQQQQQQQQQQQSGSYSPDIPKADPE
DDEDDSMDNSSTLCLQLLANSASNNNSQHLNFNAGEAPTALPTTSTMGLIQSSLDMRVIH
KGLQILQPIQNQLERSGNLSVKPECDSEAEDSGTEDAVDAELDHMELDFECGGNRSGGSD
FAINEAVFEQDLLTDVHCAFHVQPPTLVHSYLNIHYVCETGSRIIFLTIHTLRKVPVFEQ
LEAHTQVKLLRGVWPALMAIALAQCQGQLSVPTIIGQFIQSTRQLADIDKIEPLKISKMA
NLTRTLHDFVQELQSLEVTDMEFGLLRLILLFNPTLLQQRKERSLRGYVRRVQLYALSSL
RRQGGIGGGEERFNVLVARLLPLSSLDAEAMEELFFANLVGQMQMDALIPFILMTSNTSG
L
Download sequence
Identical sequences B4IAQ4 B4QK49
FBpp0203613 FBpp0210516 XP_002040814.1.34323 XP_016032832.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]