SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0204791 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0204791
Domain Number 1 Region: 817-1071
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-62
Family Nuclear receptor ligand-binding domain 0.000000000938
Further Details:      
 
Domain Number 2 Region: 743-822
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-27
Family Nuclear receptor 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0204791   Gene: FBgn0178181   Transcript: FBtr0206299
Sequence length 1075
Comment type=protein; loc=scaffold_18:complement(606652..606908,607092..608172,608306..609442,609982..610292,632089..632530); ID=FBpp0204791; name=Dsec\GM23314-PA; parent=FBgn0178181,FBtr0206299; dbxref=FlyBase:FBpp0204791,FlyBase_Annotation_IDs:GM23314-PA,GB_protein:EDW46370,REFSEQ:XP_002042458,FlyMine:FBpp0204791; MD5=1a99422555e907b64ae7a10a90f8ce00; length=1075; release=r1.3; species=Dsec;
Sequence
MMRDRLASLIVVKQEGGSNTSISHHQATAIKCEAALYTHCESSLLQEINNNSCYRQNLNA
PTHQQQAHTSHLQHAQQHQTHQQHPLLPPPLPTLPLIYPCRNLFPDGCDINHLACCSSSN
SNSNCNSDSNSTSSSPGNSHFFANGNTCAAALTPAPPATEPRKIKPLGAGKLKVGKTDSN
SDSNSNSDSRAAAATSTAATSATATTLAATAAAAAAEAGGAASAASAAAAKISQVRLTNQ
ATTSMLLLQPNSSFSSLSPFDNFSTQTASTTTTTSASAAGHHQHHNHLLHQQHHNQQQQQ
QQQQQQQQQHEHLQQQHQQHLVNPQQHLLKSETLLSHEEDQLISNLTDSSVVSHSELFSD
LFFPSDSNNSLLSPTTSGYPDNPAEDLTSSIENLTKLTCLRDKRLSSIPEQQLSSEQEQQ
LCLLSLRSSSDPAIALHAQQQQQQQQQQQQQQQQQQHQQQQHLQLQLISPIGGPLSCGSS
LPSFQETYSLKYNSSSGSSPQQASSSSTAAPTPTDQVLTLKMDEDCFPPLSGGWSASPPA
PSQLQQLHTLQSQAQMSHHGSSSNNSSNNAGNSHNNSGGYNYHGHFNAINASANLSPSSS
ASSLYEYNGVSAADNFYGQQQQQQQSYQQHNYNSHNGERYSLPTFPTISELAAATAAVEA
AAAATISSPSVGGPPPVRRASLPVQRTISPSGSTAQSPKLAKITLGQRHSHAHALQLNSA
PNSAASSPASVDLQAGRLLQAPSQLCAVCGDTAACQHYGVRTCEGCKGFFKRTVQKGSKY
VCLADKNCPVDKRRRNRCQFCRFQKCLVVGMVKEVVRTDSLKGRRGRLPSKPKSPQESPP
SPPISLITALVRSHVDTTPDPSCLDYSHYEEQSMSEADKVQQFYQLLTSSVDVIKQFAEK
IPGYFDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHRTQCLRSFGEWL
NDIMEFSRSLHNLEIDISAFACLCALTLITERHGLREPKKVEQLQMKIIGSLRDHVTYNA
EAQKKQHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPALIENMFVTTLPF
Download sequence
Identical sequences B4IFE8
FBpp0204791 XP_002042458.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]