SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0204881 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0204881
Domain Number 1 Region: 424-452,576-805
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-56
Family Nuclear receptor ligand-binding domain 0.000061
Further Details:      
 
Domain Number 2 Region: 373-457
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-26
Family Nuclear receptor 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0204881   Gene: FBgn0178271   Transcript: FBtr0206389
Sequence length 808
Comment type=protein; loc=scaffold_18:join(1179957..1181600,1181817..1182107,1182169..1182318,1183355..1183457,1183512..1183666,1184151..1184234); ID=FBpp0204881; name=Dsec\GM23404-PA; parent=FBgn0178271,FBtr0206389; dbxref=FlyBase:FBpp0204881,FlyBase_Annotation_IDs:GM23404-PA,GB_protein:EDW46451,REFSEQ:XP_002042539,FlyMine:FBpp0204881; MD5=c50be4916900e4663e3e0b3514b7b9c6; length=808; release=r1.3; species=Dsec;
Sequence
MPNMSSIKAEQQSGPIGGSSGYQIPVNMCNTTVATTTTTLGSSAGGAGATGSRHNVSVTN
IKCELDELPSPNGNMVPVIANYVHGSLRIPLSGQSNHRESDSEEELASIGNLKVRRRTAA
DKNGPRPMSWEGELSDTEVNGGEELMEMEPTIKSEAVPAVAPPQPYCALQPIKTELENIA
GEMQIQGKCYPQSNTQHHAATKLKLAPTQSDPINLKFEPPLGDNSPLLAARSKSSSGGHL
PLPTNPSPDSAIHSVYTHSSPSQSPLTSRHAPYTPSLSRNNSDASHSSCYSYSSEFSPTH
SPIQARHAPPAGTLYGNHHGLYRQMKVEAASTASSSVQEAQNLSMDSSNLDTVGLGSSHP
ASPAGISRQQLINSPCPICGDKISGFHYGIFSCESCKGFFKRTVQNRKNYVCVRGGPCQV
SISTRKKCPACRFEKCLQKGMKLEAIREDRTRGGRSTYQCSYTLPNSMLSPLLSPDQAAA
AAAAAAVASQQQPHQRLHQLNGFGGVPIPCSSSLPASPNLGETSVKSEEMGETGKQSLRT
GSVPPLLQEIMDVEHLWQYTDAELARINQPLSAFDSGRSSSSSSSATSSGAHAQLTNPLL
ASAGLSSNGENANPDLIAHLCNVADHRLYKIVKWCKSLPLFKNISIDDQICLLINSWCEL
LLFSCCFRSIDTPGEIKMSQGRKITLSQAKSNGLQTCIERMLNLTDHLRRLRVDRYEYVA
MKVIVLLQSDTTELQEAVKVRECQEKALQSLQAYTLAHYPDTPSKFGELLLRIPDLQRTC
QLGKEMLTIKTRDGADFNLLMELLRGEH
Download sequence
Identical sequences B4IFM9
XP_002042539.1.34323 FBpp0204881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]