SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0205487 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0205487
Domain Number 1 Region: 318-463,744-825
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.56e-62
Family Nuclear receptor ligand-binding domain 0.00019
Further Details:      
 
Domain Number 2 Region: 198-268
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-22
Family Nuclear receptor 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0205487   Gene: FBgn0178875   Transcript: FBtr0206995
Sequence length 1085
Comment type=protein; loc=scaffold_0:complement(13819467..13820239,13820318..13820402,13820701..13820858,13825808..13827223,13829670..13829689,13830874..13831024,13838933..13839587); ID=FBpp0205487; name=Dsec\GM24010-PA; parent=FBgn0178875,FBtr0206995; dbxref=FlyBase:FBpp0205487,FlyBase_Annotation_IDs:GM24010-PA,GB_protein:EDW42489,REFSEQ:XP_002031503,FlyMine:FBpp0205487; MD5=3cc0e646653003337ac12cf8671781f5; length=1085; release=r1.3; species=Dsec;
Sequence
MCASPSTAPGFFNPRPQSGAELSAFDIGLSRSMGLGVPPHSAWHEPPASLGGHLHAASAG
PGTTTGSVATGGGGTTPSSVASQQSAVIKQDLSCPSLNQAGSGHHPGIKEDLSSSLPSAN
GGSAGGHHSGSGSGSGSGVNPGHGSDMLPLIKGHGQDMLTSIKGQPTGCGSTTPSSQANS
SHSQSSNSGSQIDSKQNIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCGGSR
NCPIDQHHRNQCQYCRLKKVPQNGHETRSTCPRTPPVQRGRVPPTQPGLAGMHGQYQIAN
GDPMGIAGFNGHSYLSSYISLLLRAEPYPTSRYGQCMQPNNIMGIDNICELAARLLFSAV
EWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADR
VVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTGKLLDILYKDVPALLTKVSEL
LGKGSTASNDDVLAVVRDHVDELNRQEQESHAQQQAPLHLAAFMNCVAGVEAAVQQAEQA
QVPTSSASTSASAPLVPSAGSAFSSCQAKSAGSEMDLLASLYAQAQATPPSSGGGDVSGH
NNSSGLGASLPTQSQSGSSSRNLTASPLSTSLATAPAPASAPAPAPVPTSSVPQLPVPAP
VPVTSSTSSSSLGGGAYQTPSAAAAAAAMFHYQTPPRAAFGSAFDMFHHSTPFGVGVGHA
HALAHSSGSGSASFGSPSYRYSPYSLADACGLSDVTHIESLQEKSQCALEEYCRTQYPNQ
PTRFGKLLLRLPSLRTVSSQVIEQLFFVRLVGKTPIETLIRDMLLSGNTVAAATLNINSG
GGGIGIGGGGSGSGGSGGGSGVAGCGSHNVVAASHDQLANVAVMQQTYGSGSSSCHNGNN
GSGGSICNQQINNYGNNNNVGNHMSAGSFFGGANSNIHSSGNSNTDYMTTPTTAYATPAT
AATSTVNTTTMLSNYCDAATMMMAAAAVNANQCLQQHHQRMLLAGSSNSSSNSNNSSSNS
NGAAAMPSSSSAGSLSSASSTPTATATATAIATATAAATAAQQQQQQSPPNLIDISEVPL
IVDVK
Download sequence
Identical sequences B4HHF0
FBpp0205487 XP_002031503.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]