SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0206782 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0206782
Domain Number 1 Region: 430-563
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000461
Family Ran-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0206782   Gene: FBgn0180165   Transcript: FBtr0208290
Sequence length 576
Comment type=protein; loc=scaffold_0:join(4061092..4062034,4062089..4062876); ID=FBpp0206782; name=Dsec\GM25305-PA; parent=FBgn0180165,FBtr0208290; dbxref=FlyBase:FBpp0206782,FlyBase_Annotation_IDs:GM25305-PA,GB_protein:EDW41182,REFSEQ:XP_002030196,FlyMine:FBpp0206782; MD5=dbaac5e7a0de51379c67b68ccff57007; length=576; release=r1.3; species=Dsec;
Sequence
MLHCQVEGAKAEQCECPVMHSENSAETFSSVEPQASDCIQPLEVQSAKRTTNIEESFKVD
CKLSLNTLLSPINIIDPLRKQIDFQCNLGDLSFFGPVMCSISELNKEEQTLEPYFIPELY
MACAGKEVEQVAEETVIETGPQLKLPKNQPINDSITTETNETKLPPMEPLNVSRLAEFSE
PVMGKSNISIEEVNLKGAVGIIEPISDEPNIQPVESAEKLYPKSLAIQIPPLKIEDLISP
LIEKPRIATKLGLISFLTGNKLALTPSVRLSFGDRVTTRRNTKSKEIIQQQASKSLKALI
SVLTMQRRLAASQHDNSNNSRTKRFEQLKSSLSFSRVFRQNIFQSTSVIENRQLNTDGNS
LESGEPNFNSPSEHKEPLPIPYRLDAGEGLTCNGLNVSKDSVFSEVSESDVSETQNKLFA
MKKPQAGLKSIAKLSDILNNGRVLFSQPVRLFCFNKLKEWKRQGKVPRSHESPYRSPSFS
GEGQIEVIEHDGSYYIVLHDKVSGELIIHMRVDERWRIDYMTKSSYSCRWTNINYANCRD
GILERIACSFREPSHAAEFVARVRNSALQSRLECSS
Download sequence
Identical sequences B4HF13
XP_002030196.1.34323 FBpp0206782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]