SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0208063 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0208063
Domain Number 1 Region: 1147-1354
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.92e-26
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 1368-1535,1564-1585
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-16
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 3 Region: 1628-1651,1720-1875
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000127
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 4 Region: 88-251
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000302
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 946-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000931
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 831-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000135
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 7 Region: 869-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000274
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 1939-1983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000199
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 9 Region: 1978-2015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000547
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 10 Region: 423-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000073
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 11 Region: 1048-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 12 Region: 2096-2140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000165
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 13 Region: 384-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 14 Region: 347-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.039
Further Details:      
 
Domain Number 15 Region: 643-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 754-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000594
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 462-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000877
Family EGF-type module 0.012
Further Details:      
 
Domain Number 18 Region: 792-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 19 Region: 2019-2063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 20 Region: 907-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 21 Region: 303-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000174
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 22 Region: 265-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000438
Family EGF-type module 0.024
Further Details:      
 
Domain Number 23 Region: 2059-2099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000839
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 1906-1944
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.013
Further Details:      
 
Domain Number 25 Region: 2135-2173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.012
Further Details:      
 
Domain Number 26 Region: 2175-2217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family EGF-type module 0.01
Further Details:      
 
Domain Number 27 Region: 1086-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000274
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 28 Region: 1629-1686
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000408
Family Growth factor receptor domain 0.0096
Further Details:      
 
Weak hits

Sequence:  FBpp0208063
Domain Number - Region: 695-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000254
Family EGF-type module 0.0085
Further Details:      
 
Domain Number - Region: 1028-1052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000933
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 984-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0125
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0208063   Gene: FBgn0181439   Transcript: FBtr0209571
Sequence length 2292
Comment type=protein; loc=scaffold_0:join(20455680..20455911,20469447..20469791,20470102..20471094,20471222..20471350,20471565..20471885,20472410..20472936,20473237..20473781,20473841..20473946,20474012..20474206,20474266..20475037,20475103..20475285,20475376..20477136,20477205..20477329,20477396..20477809,20477876..20478106); ID=FBpp0208063; name=Dsec\GM26586-PA; parent=FBgn0181439,FBtr0209571; dbxref=FlyBase:FBpp0208063,FlyBase_Annotation_IDs:GM26586-PA,GB_protein:EDW43473,REFSEQ:XP_002032487,FlyMine:FBpp0208063; MD5=31743d562daf592999c400bc50545801; length=2292; release=r1.3; species=Dsec;
Sequence
MAKIANASLSQQQKQRQTATTTTTTVAASVETATTTARSRDRTKSAAQITSHLLKRAISV
YSSPQWIPLFILIYLATDVASVAVPTKEAYFNGSTYLRLTTPMPIWDHSAISFRSCRGGE
ILAQQYNKNSIVISVLNDFLQISLAGPAVHGPNNRLDVKLPYQLLDNRWHTLQFKYEYGN
LYLHVDRAASIFANSTYNSQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFVNNSTVQN
VVFGHCPLTPGPCSDHDLFTRLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQK
DNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACV
VIGGSGALTCECPKGYAGARCEVDTDECASQPCKNNGSCIDRINGFSCDCSGTGYTGAFC
QTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPI
GFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDLEPLTPLELDILDA
TLCPSEKKKRYISPEWLKRKRCELKLSPIGHCLPTTTTPTPEQEPTTTPRTTANPNPAIP
NTLTTTTKIPPITTSRTPVGTTTGSRKPPQQPLQSQTQRSASLNACPQENCLNGGTCLGY
SGNYSCICASGYTGYNCQTSTGDGASALTPINCNATNGKCLNGGTCSMNGTHCYCAVGYS
GDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDLPNGDYECKC
TRGWTGRTCGNDVDECTLHPKICGNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPC
LNGATCHNKINAYECVCQPGYDGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMT
GRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAK
CLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNMTLYQMSRFTDLPKVF
SQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEG
THCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACL
PYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTEREEGYDINLQFRTTLPN
GVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSKLNDSNWHKVFVAINTS
HLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQD
IMVNGKWIFPEEQDANVSYTKLENVQSGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRP
FFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDISMFIRTREPTGQVFYLG
TDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQKLDNGYNHLIEVVRNQT
LVQVKLNGTEYFRKTLSTTGLLDAQVLYLGGPAPTRESLLGATTEPGIIPVPGAGVPIED
TTVPKEADDSRDYFKGIIQDVKVSNGSLNLIVEMYSLNVTDVQVNAKPLGAVTIDRASVL
PGEVSDDLCRKNPCLHNAECRNTWNDYTCKCPNGYKGKNCQEIEFCQHVTCPGQSLCQNL
DDGYECVTNTTFTGQERSPLAFFYFQESQSDDIVSETAPKQTLKPVIDIAFRTRAGGTLL
YIDNVDGFFEIGVNGGRVTITWKLSALHFGESARFEKENTDGEWSRIYLRAHNSKLEGGW
KGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPESRQARGSTLSAQQGSQFKGCV
GEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGCILCFQSDCKNDGFCQSP
SDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNID
ECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNAST
GNNFTCTCVPGFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINEC
ESNPCQNGGQCKDLVGRYECDCQGTGFEGLRCENDIDECNVEGDYCGGLGRCFNKPGSFQ
CICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNCTAPITAK
EDGPSTTDIAIIVIPVVVVLLLIAGALLGTFLVMARNKRATRGTYSPSAQEYCNPRLEMD
NVLKPPPEERLI
Download sequence
Identical sequences B4HGM0
FBpp0208063 XP_002032487.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]