SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0208098 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0208098
Domain Number 1 Region: 522-720
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-53
Family Astacin 0.0000807
Further Details:      
 
Domain Number 2 Region: 1429-1628
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.82e-53
Family Astacin 0.00017
Further Details:      
 
Domain Number 3 Region: 1163-1271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-37
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 4 Region: 849-952
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-36
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 5 Region: 2092-2200
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-35
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 6 Region: 1779-1877
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-34
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 7 Region: 997-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-32
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 8 Region: 1925-2042
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-31
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 9 Region: 2200-2317
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-27
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 10 Region: 717-841
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1625-1648,1677-1770
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-22
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 12 Region: 1271-1360
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-17
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 13 Region: 1878-1923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000051
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 14 Region: 1112-1155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000011
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 950-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000262
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 16 Region: 2042-2086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000586
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0208098   Gene: FBgn0181474   Transcript: FBtr0209606
Sequence length 2358
Comment type=protein; loc=scaffold_0:join(20891886..20892342,20904146..20904492,20904673..20905094,20905505..20905792,20906283..20906522,20906588..20907146,20907249..20907447,20907526..20907790,20907879..20908084,20908288..20908931,20909050..20909230,20909293..20909555,20911495..20911556,20911702..20912046,20912101..20912921,20912976..20913237,20913291..20913859,20913920..20914866); ID=FBpp0208098; name=Dsec\GM26621-PA; parent=FBgn0181474,FBtr0209606; dbxref=FlyBase:FBpp0208098,FlyBase_Annotation_IDs:GM26621-PA,GB_protein:EDW43536,REFSEQ:XP_002032550,FlyMine:FBpp0208098; MD5=fc80c146c4f61d2aec0b83be6b0972a9; length=2358; release=r1.3; species=Dsec;
Sequence
MRRRRGTPLGVSWTNCVLLLATGLLVVLISVHAKNPRPHRGLPAPAPAPVPESVDQVATE
NGHRREPTVDGSVLQRLSGSDRAVDEDEDVDEDGDEGLKHQHLEHRQQFDAYLGTIRRLR
RPYRSKYTIEQLMRLHVTPKVSEDIDMDPCKAGGFMDDIALPEGDSGPVIAHTPINDEEH
ERQEVEQLLADSPSPVHDPASVSGAANSGPTKFNATFQLELEKLKQEVYHEGLQVEEEGL
TDIIRKKTKLPSSGPVNLKAGQSQSQSQSANEPVKPGSESPSDYAQASSYKNEVLPPSEQ
RIHTDKPARLTLAEIGPKSSNKTQSLHRNVDTRKIQSDNKDIEDDSGNNFVAKRRPSQIV
PTSLPEQRSTPAHVYSNAGGNGMQLDDEVDFLHSRGVVRRRHRRGPKQRRSNQHLEHEAK
LQRLKEELSRPVIKGHHRQSHHQKQAQHRQHHQSHHRKKHRRQQQHHRRRGQSTTQYVNH
SPPGFNQSQQAQQQSVPEMDLLKAETPKNKEPLRHRVARAVTAKKERIWDYGVIPYEIDG
NFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGPQAI
SIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDS
LGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKC
PKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCE
TDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDVVC
GGELFVDDAVGRLESPNYPLDYLPNKECVWKITVPDSYQVALKFQSFEVENHDNCVYDYV
VVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECET
QNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPETYPLL
KECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSS
IPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMC
HNGYSMHENGHDCKEGECKYEISAPFGSIFSPNYPDSYPPNADCVWHFITTPGHRIKLIF
NEFDVESHQECTYDNVSVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQK
NGFRASHSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTF
DIESSENCTFDYVQVFSDIDDVYGQYEPMYGQYCGNVVPPKRPKDGIHQLKTARQYSGRR
RKQPHKSRNKAARRLPPPFLWTDDAVDVLQHSHSPTLNGQPMQRKRRAVTVRKERTWDYG
VIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDANLHANYIYFTVKNCGCCSFLGK
NGNGRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDV
LSPEEVDLPLLPYDLNSIMHYAQNSFSKSPYLDTITPIGIPPGTHLELGQRRRLSRGDIV
QANLLYKCASCGRTYQQNSGHIVSPHFVSSGNGVLSEFEGSGDAGEDPSAESEFDASLTN
CEWRITATNGEKVILHLQQLHLMTSDDCTQDYLEIRDGYWHKSPLVRRICGNVSGEVITT
QTSRMLLNYVNRNAAKGYRGFKARFEVVCGGDLKLTRDQSIDSPNYPLDYMPDKECVWRI
TAPDNHQVALKFQSFELEKHDGCAYDFVEIRDGNHSDSRLIGRFCGDKLPPNIKTRSNQM
YIRFVSDSSVQKLGFSAALMLDVDECKFTDHGCQHLCINTLGSYQCGCRAGYELQANGKT
CEDACGGVVDATKSNGSLYSPSYPDVYPNSKQCVWEVVAPPNHAVFLNFTHFDLEGTRFH
YTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSVLRLEFYSDRTVQRSGFVAK
FVIDVDECSMNNGGCQHRCRNTFGSYQCSCRNGYTLAENGHNCTETRCKFEITTSYGVLQ
SPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQECIYDYVAIYDGRSENSSTLG
IYCGGREPYAVIASTNEMFMVLATDAGLQRKGFKATFVSECGGYLRATNHSQTFYSHPRY
GSRPYKRNMYCDWRIQADPESSVKIRFLYFEIEYSERCDYDYLEITEEGYSMNTIHGRFC
GKHKPPIIISNSDTLLLRFQTDESNSLRGFAISFMAVDPPEDSVGEDFYAVTPFPGYLKS
MHSSETGSDHLLPPSRLI
Download sequence
Identical sequences B4HH60
XP_002032550.1.34323 FBpp0208098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]