SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G000781_T01|PACid:20854936 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G000781_T01|PACid:20854936
Domain Number 1 Region: 7-61
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000164
Family 7-Fe ferredoxin 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G000781_T01|PACid:20854936
Sequence length 80
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIHWDGCKAKQIASAPRTEDCVGCKRCESACPT
EFLSVSVYLGPETTRSMALS
Download sequence
Identical sequences GRMZM2G000781_T01|PACid:20854936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]