SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G134382_T06|PACid:20838445 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G134382_T06|PACid:20838445
Domain Number 1 Region: 62-110
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000467
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G134382_T06|PACid:20838445
Sequence length 119
Sequence
MAQRRLLGTAPAPAGDAASHGSGSSPDAMRIMVGVLVTVIVCTLLYCVYCWRWRKRNAIR
RSLLDSLWRRSSSDLPLMDLASILAATDNFSKANKLGEGGFGPVYRVRNQPKVDGCGHS
Download sequence
Identical sequences GRMZM2G134382_P05 GRMZM2G134382_T06|PACid:20838445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]