SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G148188_T01|PACid:20855994 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G148188_T01|PACid:20855994
Domain Number 1 Region: 20-115
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000196
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G148188_T01|PACid:20855994
Sequence length 178
Sequence
MDEMKSTNTSIAPEVEVHPGFSPSRFVKVFMQGEVVGRKINLATHQNYASLSFALKRLGN
NYSMPSCELNGLVNNEVDGASDDNNFILFYDTMDGDRLFVGEVPWEIFVISVKRIYIVRV
PQEQENVADNGEEEDRENGEDNAAVSATALDGDDIPANDDDDDVVDDGDATATTPADG
Download sequence
Identical sequences GRMZM2G148188_T01|PACid:20855994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]