SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G164117_T04|PACid:20856812 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G164117_T04|PACid:20856812
Domain Number - Region: 6-47
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0192
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G164117_T04|PACid:20856812
Sequence length 53
Sequence
MDCWLKLPKCCTCNRPYCERHSNLKENLSASGQFTCQECAAFATSLRSRGEGY
Download sequence
Identical sequences GRMZM2G164117_P04 GRMZM2G164117_T04|PACid:20856812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]