SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM5G852325_T01|PACid:20831829 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM5G852325_T01|PACid:20831829
Domain Number 1 Region: 7-61
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000221
Family 7-Fe ferredoxin 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM5G852325_T01|PACid:20831829
Sequence length 62
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
DF
Download sequence
Identical sequences A0A218LHZ1
GRMZM5G852325_T01|PACid:20831829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]