SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM5G864166_T01|PACid:20852179 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM5G864166_T01|PACid:20852179
Domain Number 1 Region: 118-208
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000173
Family 7-Fe ferredoxin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM5G864166_T01|PACid:20852179
Sequence length 426
Sequence
MVVPVPPPPLLASHVAVRAAASAISHGRRVLLNGDHPPQVAALGRGDWVKLICGASFEDA
ADVRNLSLVYTLAGVDCIDCAADASVVGAVNEGIEVAASIVPTVQRPWLMISVNDDCRDL
HFRKAEFDPDDCPLDCSKPCEKVCPADAISLKHSMVDGERTLSDPLRGKYEGGVITERCY
GCGRCLPVCPYDRIRAVSYVRDPTMTAELLKRDDVDAIEIHTTGKGTDMFNTLWDNLSGS
INNVKLVAVSLPDIGESTVDLMNTIYTIMEPHFKGYNLWQLDGRPMSGDIGRGATRETVS
FAAHVASMSERPPGFYQLAGGTNSYTVDYLKKAGLFQSSNWNSGTATSEMASSHQALIGG
IAYGGYARKIVGRVLRKIPEQFGRVHIEDHPDHLLEALQEAMSLVGPVKGYIPSHSKPFM
KQVDRQ
Download sequence
Identical sequences B4FL73
GRMZM5G864166_T01|PACid:20852179 NP_001136908.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]