SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC190688.3_FGT006|PACid:20852333 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC190688.3_FGT006|PACid:20852333
Domain Number 1 Region: 105-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000042
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  AC190688.3_FGT006|PACid:20852333
Domain Number - Region: 362-389
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0824
Family Hairpin loop containing domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC190688.3_FGT006|PACid:20852333
Sequence length 504
Sequence
MASNRALFVLPMLLAVAVLLPEQIALSSADFPLGRQATVQLPPAPYQPGFAARAVVLDAK
QGHRQPAFAAAVSAEAGAGRCTCSLVVLLGGVKVWASDHLEKFVPAALCRLELTEDGQLR
LTDGAGKVGWLSGTAGQGVKALHLDRRTGNLVLLDAQNCTMWQSLDDPTDTFLRGQQRRL
PVYLIAPTTNMAASSVFYSFELDGDRIATYVNFGDTRYSYWELAPPANRTMAAARLNGSG
LGMLDLRGVTVAQITPPVKKPPVSFLALGGDGNLVMYYYDTRHQKFRASYKALGFCQLPL
SCSVHEVCSSAGKCKDFSEYADRPAARAGNASSSNPREGAGDKARMVHLRGVTTVLRTAS
PLANVTLRECVVQCARNLSCNAALYVRDNAGVAAADHGVCSHYKVTAGAREVTDGSRRYS
YWVKFPEAAAGGDEEDDDSSPGTSTILMICGAIDVVCALVFVLLISLYFCRLRRQAAAVD
RVVELQECDGEGAREHNDTDSNGS
Download sequence
Identical sequences AC190688.3_FGT006|PACid:20852333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]