SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC217263.3_FGT007|PACid:20829270 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC217263.3_FGT007|PACid:20829270
Domain Number 1 Region: 115-217
Classification Level Classification E-value
Superfamily At5g01610-like 3.4e-28
Family At5g01610-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AC217263.3_FGT007|PACid:20829270
Sequence length 317
Sequence
MTCSCGAEKREGGSSGKGKKNVSLALHAWHAVGRTVPVLAVMDSIDHSRLQVNRQRPGYE
ADHQPELEQSVNFSSSSVQIYLTNYGAACYWSRASARVAQRRGERPAPQVRPPEKGLIPN
SVASYSFDEATGAFEIHLAGTCYVHFGSHLVYYERTITGKLSKGAISDLSGVQAQKLFLW
VYVTGMVALPDQGTIEFQSGFISESLSASMFDEVPTCGSSVGAQLRGATGVIGELGLLPV
AQVGGLGRFAVDGRAGPAVIRRRGVPRAGGVRVVDQACIAASVREKRLEASWIRGGCYAL
AGAVYKPGLIVSTDTVL
Download sequence
Identical sequences AC217263.3_FGP007 AC217263.3_FGT007|PACid:20829270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]