SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G002859_T02|PACid:20878405 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G002859_T02|PACid:20878405
Domain Number 1 Region: 45-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.39e-25
Family BAR domain 0.091
Further Details:      
 
Domain Number 2 Region: 300-359
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-17
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G002859_T02|PACid:20878405
Sequence length 368
Sequence
MEAIRKQASKFREQVARQQQAVMKQFGGGYGADGVFANEAEAQQHSKLEKLYISTRAAKH
FQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCSSGSTLSKAALSFAKARSMME
KERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAIEVSKRQMKLRE
ASGNSDMVSRLEAAESKLQELKSNMGVLGKEAVAAMTAVEAQQQRLTLQRLIALVESERN
YHQKVLQILDQLEREMVSERQRIEGAPPVVESSMPPPPAYEEVNGIFMRNTVAELVETVE
YFLAEAIQSYQAESDTELNLSTGDYIVVRKVSNNGWAEGECRGKAGWFPYDYIEKRERVL
ASKVAQVF
Download sequence
Identical sequences B4G128
XP_008681397.1.34533 GRMZM2G002859_T02|PACid:20878405 GRMZM2G002859_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]