SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G010962_T01|PACid:20841942 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G010962_T01|PACid:20841942
Domain Number 1 Region: 80-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-26
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  GRMZM2G010962_T01|PACid:20841942
Domain Number - Region: 356-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00173
Family Hairpin loop containing domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G010962_T01|PACid:20841942
Sequence length 433
Sequence
MATSKKGLMAMVYIRSAFILIFLSSPCQSNDQLTQTKPLLLEDTLISEGGDFALGFFSPT
NSSKKLYIGIWYHRVTERTVVWVANRDNPITTPSAMLAITDNLELVLSDSQGHTLWMATG
NTSGDAGGAASAVLLNSGNFVLRLPNGTEVWHSFDHPTDTILPTMRILLSFKTQPATRLI
AWKGPDNPSTGDISSGMDSTNLQMFIWKGALPYYRFPVVNDMAVAGAMYQQSNGNAAIMY
ETRVNAGDALYYTYTVSSGSPYTRFSLDYTGKGRLLSWNSTTSSWTVIIEHPHSCDLYAS
CGPFSYCDQMGPLPTTCQCPDGFELLNSLNFSRGCRRKEELKCGVGNYFMAMSSMKLPDK
FLHIKNRTFDQCADECTRNCSCMAYAYANLSSIGAVGDTSRCLVWSGDLIDMEKNSFSEV
LYIRLGGSDRLIT
Download sequence
Identical sequences GRMZM2G010962_T01|PACid:20841942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]