SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G017164_T01|PACid:20872593 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G017164_T01|PACid:20872593
Domain Number 1 Region: 487-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-75
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 65-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-20
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Weak hits

Sequence:  GRMZM2G017164_T01|PACid:20872593
Domain Number - Region: 368-404
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0271
Family Anti-platelet protein 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G017164_T01|PACid:20872593
Sequence length 800
Sequence
MAAPLLFPLLLLLLLLSSSTTPLQAQQNFTQGSSLTPQGPTTSWLSPSGDFAFGFQPIEG
NTSFYLLAVWFNKIGNLTVTWYAKTNDPDPAPVQAPSGSRLQLNSNGALSLQDSAGTEVW
NPQVVGASYAAMLDSGNFVLAAADGSALWESFKYPTDTILPTQVLTTGMSLRSRIIPTDY
SNGRFLLGLQSTGASLYTVAVPSGYEYDPYWSMDVNTTNLVFDASGVIYIGNRSEITSWV
VSSIADYYLRATLDPDGVFRQYMYPKKNSNQSNQAWSVVDFKPPNICGAQLTNVGSGICG
FNSYCTWNGANNQSTCKCPEQYSFIDDERKYKGCKPDFQPQSCDLDEAAALMQFKVIPMS
HVDWPLSDYEQYSPITKDQCQQLCLTDCFCALAVFHDEDNTCWKKKMPLSNGQMADGVQR
TVYIKVRKDNGTQSEIVDSNKWKKDKKNWIIGSSLFLGSSVLVNLLLISIILFGTYCTIT
IKEVPAMQSSNSIGLPLKAFTYAELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVK
KIDKLEHETEKEFTIEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGD
AKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKSQNILLDGNFTAKISDFGLAKLLR
TNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEATDEDQK
ILTDWANDCYRCGRIDFLVEGDEEAISDLKNVERFVAVALWCLQEDPTMRPTMLKVTQML
DEAAAVPSPPEPTSFVSALA
Download sequence
Identical sequences K7U294
XP_008663071.2.34533 GRMZM2G017164_T01|PACid:20872593 GRMZM2G017164_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]