SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G022514_T01|PACid:20855537 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G022514_T01|PACid:20855537
Domain Number 1 Region: 368-676
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.1e-72
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 46-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.13e-54
Family Legume lectins 0.000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G022514_T01|PACid:20855537
Sequence length 757
Sequence
MTTGPWRWCHGVRATASLALLLLLACVSGRSVTCARAQSTAFTGRETTSFSFPKFDQNRL
QLSTNLTFTGNSTVSQGALQVTPDSGNNFSTYLANQAGRVFYSTPFVLWASNASSAAAAG
RRVASFSTVFQFNLYRTNASVKGEGLAFVVASAIADPPPGSHGGFLGLTNASTDGLGANG
FAAVELDTVKQPYDPDGNHIGLDVNGVRSSSATCPLAALGIELAPADTGASDGSNFVWVD
YDGAARRLRAYISPNATKPSAAALDASLDLSAVVAARDAYFGFSASTGADDYQLNCVKMW
NMTVEVLHDDDDRLPKKLSGWKLGLAVGAPCAAALAALALLAGLYLMKKRRKVGDDPSSV
SHSAIDLRSIPGVPKEFDYEALRKGTNGFDDKMKLGQGGYGVVYRATVPGDNGRSMEVAV
KQFSGANTKGQEDFLAELGIINRLRHRNLVKLIGWCHQDGVLLLVYDYMPHGSLDRHLFG
GREASAAATTTTTLDWKQRYNVVAGVASALNYLHHEFEQTVIHRDIKPSNIMLDSSFHAR
LGDFGLARALESDKTSYTDKLGVPGTLGYIAPECFHTGRATRESDVFGFGAVVLETVCGR
RVSCDNPAGCSQLLELVWRLHGAGRLLEAVDPRLAAGGYGYDGEEAERLLLLGLACSHPN
PRQRPKAQAILQNLQTRSVPPLPVPMSKPVFMWPAPLADGEEDATQASSMSRSGVTSSGV
TSSSNYPYTWSSSGYNTQTFQVSREVHDAAERDVATV
Download sequence
Identical sequences GRMZM2G022514_T01|PACid:20855537 XP_008679028.1.34533 GRMZM2G022514_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]