SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G038669_T01|PACid:20883160 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G038669_T01|PACid:20883160
Domain Number 1 Region: 83-162,227-248
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000314
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 
Weak hits

Sequence:  GRMZM2G038669_T01|PACid:20883160
Domain Number - Region: 372-407
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00053
Family Pan module (APPLE domain) 0.044
Further Details:      
 
Domain Number - Region: 224-288
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00652
Family alpha-D-mannose-specific plant lectins 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G038669_T01|PACid:20883160
Sequence length 511
Sequence
MEAIVLVQLVAAAALISSLIGGAAGEAVAQELRQGLSVAHDQSYSQFQPVLADPTGVFAL
GFLRVNSTMLDLAVVHLPSAFPLWRAIPDRPAPWSTAASLSFDGGLFLTDRAADKVLWST
AATSASAGDRAVLLNTSNLQIQSTGGSSSPDVVWQSFDYPSETIVQSQNFTSAATLHSFD
RRFAMRLGSNYFGLYIEPPPSSGGVAAAMYFKHTAMEAKAQIVAGGGPTYARVEPDGFLA
MYQREGPPADVLSFDTFNRGVRALRRMTLEPNGNLRAYYWNGARWALDYTAINDNDRCEL
PTTCGAYSVCAEPSGSCECLANATDGSGCAAAVPASVASSLCGTTGGEVGGLYWAVRRQG
VEPVNKELLRSEQAASATDCEARCERNCSCWGAVYSNGTGVCYVMDYPAQLLVAGDDRKM
GYFKIRSLEEEGTRGHGGGRASGVKAALLVVGVAVVVAAAAFGAYRVWDRRRRSAVDARR
QIGAADDGLSPGPYKNLGSFSSVELTNSFRR
Download sequence
Identical sequences A0A1D6H9Q0
GRMZM2G038669_T01|PACid:20883160 GRMZM2G038669_P01 XP_008645742.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]