SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G046274_T01|PACid:20864769 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G046274_T01|PACid:20864769
Domain Number 1 Region: 44-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-21
Family Arfaptin, Rac-binding fragment 0.072
Further Details:      
 
Domain Number 2 Region: 311-369
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-16
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G046274_T01|PACid:20864769
Sequence length 380
Sequence
MEALKKQASKLREHVAKQQQAVLKQFSTRYSQDPSLVDEAELECHQNLQRLYSTTRAAKH
FQRNIVRGVEGFIAVSTKQMEIVKKLAGDCCKYGDDNQHFGFALARASEEFGKSHKQIEK
EREDLLKILGEQIFEPLREMIMSAPLEDARLLTYRYQRIRQDMESQIADVMRKQLKSKES
SGNTDNSVKLQHAESKLSDLRTTLAALGREATAAMEAVEAQQQQVTYERLLAMVDAERTY
HQNAADILNKLHDEMLYAKHHNESANHYDEQSSEPESDAGPAQVHSRSTSEDPVLTKPSE
STGNSQEVQFLGEVIHPFDAQADGELSLAVGEYVVVRQVAANGWSEGECKGKAGWFPSAY
VEQRDRAPASKVIEPGLLTT
Download sequence
Identical sequences B6THR5
NP_001149747.1.34533 GRMZM2G046274_P01 GRMZM2G046274_T01|PACid:20864769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]