SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G050709_T01|PACid:20872918 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G050709_T01|PACid:20872918
Domain Number 1 Region: 96-170,275-302
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000209
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  GRMZM2G050709_T01|PACid:20872918
Domain Number - Region: 381-424
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000122
Family Pan module (APPLE domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G050709_T01|PACid:20872918
Sequence length 516
Sequence
MRQGKGDPAIAALAIAIAVVLLCVASSAVLAIDGAKAEEELPTQLLNGFAATHAAGSAAT
FEPVLYATSAVFALGFLRVGPASLDLAVVHLPSSFPVWRATPARLGDWSRPATLAFDDGT
LVLAGPDGAVLWRTLNTVGDTVALLNSSNLVVQRYENPQPAWQSFDHPADTLVVDQNFTA
SSSPLVSANRRFTLQLGRTYMAMHMQFDAGQAQAATAPVYWKHTALEAHLENATAPPVYG
RLDALGFFGLYLDGGGGQRVDVLSFDTFALNLTGVFRRMTLDDDGNLRAYYWTTGDSSAW
TSDYKAIAERCELPTSCGAYGVCVPGNAQCQCLDSNGTSTAPPCHGEDTADLCSTASSNG
ARQLGFDVVRRTRVSVAYKEELPFRTNTTADGCELACAGNCTCRGALYNGASGYCYLIDF
PVETLVYQADDRMLGYFKIRKAATANSARRGMSPGVTAATVALSLVLAGLAAAGAYWGYR
TWERRKRKRAGMEQELVPGPYRDLKSMASSNNSFKA
Download sequence
Identical sequences B4FB05
GRMZM2G050709_T01|PACid:20872918 GRMZM2G050709_P01 NP_001130912.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]