SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G098037_T01|PACid:20872294 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G098037_T01|PACid:20872294
Domain Number 1 Region: 483-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-72
Family Protein kinases, catalytic subunit 0.00046
Further Details:      
 
Domain Number 2 Region: 65-161,193-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-28
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  GRMZM2G098037_T01|PACid:20872294
Domain Number - Region: 355-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00373
Family Pan module (APPLE domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G098037_T01|PACid:20872294
Sequence length 802
Sequence
MHLLAALCGILFSLLHTPTCSAATDTLSRGGSLAGDARLVSSNGKYALGFFETNSNNPTH
NASNSYLGIWFHKVPKLTPVWSANGDNPVSSPASPELMISDDGNLVIIADDGTKVWWSTQ
ANITANTTVVVAVLLADGNLVLRSSSNSSDVFWQSFDHPTDTLLPGAKLGRNKVTGLDRR
FVSRRNSNDQAPGVYSMGLGPGALDESMRLSWRSTEYWSSGEWNGRYFDAIPEMSGPRYC
KYMFVTSGPEFYFSYTLVNESTAFQVVLDVSGQWKVRVWDWDRNDWITFSYSPRSKCDVY
AVCGAYGICSNNAGPLCSCMKGFSVRSPEDWEMEDRAGGCIRDTPLDCNATSMTDKFYPM
PFSRLPSNGMGLQNATSAESCEGSCLSSCSCTAYSYGQGGCSLWHDDLTNVAADDDTGET
LYLRLAAKEVQSWQDRHRHGMVTGVSVAVGVSTATVITLVLVSLIVMMIWRRSSSHPADS
DQGGIGIIAFRYADIKRATNNFSEKLGTGGFGSVFKGCLGESVAIAVKRLDGAHQGEKQF
RSEVSSIGIIQHVNLVKLVGFCCEGDRRLLVYEHMPNRSLDFHLFHQSAHGGGTTGLRWD
IRYQIALGVARGIAYLHHSCRDCIIHCDIKPQNILLDASFVPKIADFGMAKFLGRDFSRV
LTTMRGTVGYLAPEWISGTAITSKVDVYSYGMVLLDIVSGRRNAGREASTDGDCCHAKCC
FPVQVVDKLLNGGVGSLVDASLGGDVNLDDVERVCRVACWCVQDNEYDRPTMVEVVQFLE
GLSEPDMPPMPTFLHAIAGGSP
Download sequence
Identical sequences K7UIF8
XP_020401679.1.34533 GRMZM2G098037_T01|PACid:20872294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]