SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G104166_T01|PACid:20841821 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G104166_T01|PACid:20841821
Domain Number 1 Region: 77-173
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-16
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 2 Region: 5-70
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000314
Family BAR domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G104166_T01|PACid:20841821
Sequence length 185
Sequence
MVSKLEAAEYKLEELKSNMVGLGKEAIAAMSAVEAQQQRLTLQRLIALVEAERTYHQRVL
EILDKLEEEMVSERQKIEAPPTPAAENYIPPPAPPSYDEINGAFASTSVNESVQSVDFFL
GEALDSFNAESEFELTLSAGDIVIVRKISSNGWAEGECKGKAGWFPHAYIERQERVLASK
VPHIF
Download sequence
Identical sequences GRMZM2G104166_P01 GRMZM2G104166_T01|PACid:20841821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]