SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G104166_T02|PACid:20841819 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G104166_T02|PACid:20841819
Domain Number 1 Region: 41-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.81e-26
Family BAR domain 0.083
Further Details:      
 
Domain Number 2 Region: 261-356
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000368
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G104166_T02|PACid:20841819
Sequence length 368
Sequence
MEALWKQASRLKDQVSRQGVFKQFGYGNSDNAFTDESEVKLHQRLEKLYLSTRAAKHFQR
DIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVGNTCTSGDTLSKAATYFGKARSQMEKER
GNMLKAFGTQVAEPLRAMVMGAPLEDARHMAQRYDRTRQEAEAQAVEVSRRQNRVRESTG
NGDMVSKLEAAEYKLEELKSNMVGLGKEAIAAMSAVEAQQQRLTLQRLIALVEAERTYHQ
RVLEILDKLEEEMVSERQKIEAPPTPAAENYIPPPAPPSYDEINGAFASTSVNESVQSVD
FFLGEALDSFNAESEFELTLSAGDIVIVRKISSNGWAEGECKGKAGWFPHAYIERQERVL
ASKVPHIF
Download sequence
Identical sequences B4FYF0
GRMZM2G104166_P02 GRMZM2G104166_T02|PACid:20841819 NP_001141834.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]