SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G104166_T03|PACid:20841820 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G104166_T03|PACid:20841820
Domain Number 1 Region: 20-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.74e-24
Family BAR domain 0.083
Further Details:      
 
Domain Number 2 Region: 227-322
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000315
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G104166_T03|PACid:20841820
Sequence length 334
Sequence
MRLQMSQRLNCIRDWKSFTYRLVLLKDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVGN
TCTSGDTLSKAATYFGKARSQMEKERGNMLKAFGTQVAEPLRAMVMGAPLEDARHMAQRY
DRTRQEAEAQAVEVSRRQNRVRESTGNGDMVSKLEAAEYKLEELKSNMVGLGKEAIAAMS
AVEAQQQRLTLQRLIALVEAERTYHQRVLEILDKLEEEMVSERQKIEAPPTPAAENYIPP
PAPPSYDEINGAFASTSVNESVQSVDFFLGEALDSFNAESEFELTLSAGDIVIVRKISSN
GWAEGECKGKAGWFPHAYIERQERVLASKVPHIF
Download sequence
Identical sequences B4G167
GRMZM2G104166_T03|PACid:20841820 GRMZM2G104166_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]