SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G113158_T01|PACid:20866435 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G113158_T01|PACid:20866435
Domain Number 1 Region: 479-770
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 77-169
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-20
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  GRMZM2G113158_T01|PACid:20866435
Domain Number - Region: 208-263
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.038
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G113158_T01|PACid:20866435
Sequence length 852
Sequence
MRPLRRSSGGLAALGCCLFLLPLLSRGADMPLGSTLSPGNSATWTSPNSTFSLGFTASAS
SPSLFVAAITYAGGVPVWSAGNGAAVDSGSSFRLSSNGDLQLVNGSGAVLWSSNTGGQNV
SAAAVQETGNLVLKDKTGAALWQSFDHPTDTVVMSQNFTSGMNLTSGSYAFSVDRATGNL
TLRWTGAGSTVTYFNRGYNTSFTGNKTLTAPTLTMQTNGIVSLTDGTLTSPAVVAYSSNY
GESGDMMRFVRLDADGNFRAYSAARGSNAATEEWSAVADQCQVFGYCGSMGVCSYNGTSP
VCGCPSLNFQLSDPSKPRAGCTRKLELASCPGNSTMLELDNTQFLTYPPEITTEQFFVGI
TACRLNCLSGGSCVASTALSDGSGLCFLKVSSFVSGYQSAALPSTSFVKVCSPPLPNPAP
GSAAAPSAGGSGFRAWVVAVVVLGVVSALVLCEWALWWFLCRHSPKYGPASAQYALLEYA
SGAPVQFSYRELQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFRME
VATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDAFLFGDAPPGGKMPWPTRFAVA
VGTARGITYLHEECRDCIVHCDIKPENILLDEHFNAKVSDFGLAKLVNPKDHRHRTLTSV
RGTRGYLAPEWLANLPITAKSDVYSYGMVLLETVSGRRNFDVSEETRGKKFSVWAYEEYE
RGNLAGIIDRRLPAEDLDMAQVERALQVSFWCIQEQPGQRPSMGKVVQMLDGVMELERPP
PPKSSDSFFSTTTASGGNSSMVSTVASSAAPPVAPSTSPNLEQEMALGRSESARNRDRVT
RQLLSPQPYMTM
Download sequence
Identical sequences A0A1D6LBB2
XP_008665731.1.34533 GRMZM2G113158_T01|PACid:20866435 GRMZM2G113158_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]