SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G117250_T01|PACid:20869451 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G117250_T01|PACid:20869451
Domain Number 1 Region: 496-803
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-77
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 57-165,197-227
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-21
Family alpha-D-mannose-specific plant lectins 0.0059
Further Details:      
 
Weak hits

Sequence:  GRMZM2G117250_T01|PACid:20869451
Domain Number - Region: 360-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00114
Family Pan module (APPLE domain) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G117250_T01|PACid:20869451
Sequence length 812
Sequence
MSLAAAVATALAVLAYSCTAADPDTVSARRPLRGNGTVVSAQGKFELGLFSPGASGRFYL
GIWYKNVPVQTVIWVANRASPLSSAASAELRVSPDDGNLELVGLIQNSASPAVAWSSNMS
LSPSTSPSPSPGSNIAVMRDDGNLVLLGGDDSSTVLWQSFDHPTDTLVPYAWLGENKVTG
EYQTLTSWRDAEDPAPGMFTDTVDRNGSSEFFLLWNGSRAYWRSGVWTGSVFANLPEAVN
NVLFNQTYVDTPAYRRVTSVLYDNATITRMVLDLTGQTKQYIWVPGSQSWQFFWAAPTVQ
CDVYSLCGAFGVCSRRSQPPCQCPRGFAPAAERDWGLSDWSAGCQRSAPLLCGGNGRPTD
DGFLELPDMKLPDDPLAVSVRTRAECESACLNNCSCQAYAFSGDGSCAVWNDGFRNLEQL
YADAGNSSAATLYLRLPESELHGAKRKSRRLWLVLGIILACLAALGASALVAWVLLSRRK
RRRSEMADQLKGSSLQVYSCGDLRAATKNFSEMLGGGGFGTVYRGVLNGGTEVAVKKLEG
LRQGDKQFRTEVSTLGLIKHVNLVQLLGFCSSGDEKMLVYEYMRNGSLDAYLFGGSGRQR
PSWRDRCGIMVGIARGLAYLHEGCRECIIHCDVKPENILLDGDLCPKIADFGMAKLVGRD
FSRVLTTMRGTIGYLAPEWISGLPISAKADVYSFGMLLFELISGRRNADAGHGSDADEGD
AGGQQRPPSTFFPVWAASRVVAGDMAAVADPRLRGDVVEGELERACRVACWCIQDQEAHR
PAMAQVVQALEGVVDVQMPPVPRVLQHLATMT
Download sequence
Identical sequences A0A1D6KL97
GRMZM2G117250_T01|PACid:20869451 XP_008664520.1.34533 GRMZM2G117250_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]