SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G123604_T02|PACid:20838564 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G123604_T02|PACid:20838564
Domain Number 1 Region: 496-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-79
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 91-226
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-21
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  GRMZM2G123604_T02|PACid:20838564
Domain Number - Region: 377-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0153
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G123604_T02|PACid:20838564
Sequence length 840
Sequence
MEVMSGWLWKTALMEVPRKHHSPPKWSVILWMLVTANLWIMCSSSTQKKVLMPGFSASEM
DYIDNDGKFLLSNGYVFGFGFATVSVSDSTYYVLAVVHLPTTSIVWSANANSPVSHSDNF
VFDKDGNAYLQSGGSTVWTANISGKGATSMQLLDSGNLVVFGKDGSSPLWQSFSHPTDTL
LSGQSFIEGMSLLSHSNAQNMTYTLEIKSGDMLLYAGFQLPQPYWSALQDNRVIIDKNGN
NNIYSANLSSGSWSFYDQSGLLQSQLVIAQQQGDANTTLAAVLGNDGLINFYMLQSVNGK
SALPITVPQDSCDMPAHCKPYSICNSGTGCQCPSALSSYANCDPGVISPCNSKNKFQLVQ
LDSAVGYVGTRFTLPVPKTNLTGCRNACMGNCSCIAVFFDQTSGNCFLFDQIGSLQQKDG
GKSSLASFIKVSSSNGGSGQGGSSDNGRLTIVIVVIIVGTLAVIGVLVYVGFCIYRRSHH
TPSQDGGGSSEDDGFLHTISGAPTRFTYRQLQDATNNFSDKLGQGGFGSVYLGTLPDGSR
IAVKKLEGMGQGKKEFRSEVTIIGSIHHIHLVKLRGFCAEGAHRLLAYEYMAKGSLDRWI
FQRNEDSSLLDWDTRFSIALGTAKGLAYLHHDCESKIIHCDIKPENVLLDDNFLAKVSDF
GLAKLMTREQSHVFTTLKGTRGYLAPEWITNYAISEKCDVYSYGMVLLEIISGRKSYDPV
EGSEKAHFPSYAFKKLEEGDLRDISDSKLKYKGQDSRIEMAIKVALWCIQEDFYQRPSMS
KVVQMLEGVCDVPQPPMSSHIGYRLYANAFKSSSEEGTSSGMSDYNSDALLSAVRLSGPR
Download sequence
Identical sequences C0HFM8
GRMZM2G123604_T02|PACid:20838564 GRMZM2G123604_P02 NP_001288447.1.34533 XP_008659523.1.34533 XP_020399407.1.34533 XP_020399408.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]